7figureautomation.com


Keyword Suggestion

Notice! No data available for this site.



Domain Informations

7figureautomation.com lookup results from whois.godaddy.com server:
  • Domain created: 2015-06-14T00:10:10Z
  • Domain updated: 2025-08-28T05:35:06Z
  • Domain expires: 2026-06-14T00:10:10Z 0 Years, 187 Days left
  • Website age: 10 Years, 177 Days
  • Registrar Domain ID: 1938475177_DOMAIN_COM-VRSN
  • Registrar Url: http://www.godaddy.com
  • Registrar WHOIS Server: whois.godaddy.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: 480-624-2505
  • Name server:
    • JO.NS.CLOUDFLARE.COM
    • VASILII.NS.CLOUDFLARE.COM

Network
  • inetnum : 104.16.0.0 - 104.31.255.255
  • name : CLOUDFLARENET
  • handle : NET-104-16-0-0-1
  • status : Direct Allocation
  • created : 2010-07-09
  • changed : 2024-11-25
  • desc : All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse,Geofeed: https://api.cloudflare.com/local-ip-ranges.csv
Owner
  • organization : Cloudflare, Inc.
  • handle : CLOUD14
  • address : Array,San Francisco,CA,94107,US
Abuse
Technical support
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 104.21.1.78
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 104.21.1.78

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 104.21.1.78)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 104.21.1.78)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with 7figureautomation.com

Found 0 emails of this domain

Recent Searched Sites

Crousthistoire.com (6 seconds ago) / FR

Oro.roma.it (6 seconds ago) / US

Maruojozo.jp (3 seconds ago) / JP

Brezpanike.si (2 seconds ago) / DE

Sis.ciu.edu.tr (6 seconds ago) / TR

Pomoc.aftermarket.pl (2 seconds ago) / PL

Matsuchiro.janeapp.com (2 seconds ago) / US

Makeinsalford.com (6 seconds ago) / GB

Holytrinitystore.com (0 seconds ago) / US

Sitwgroup.com (8 seconds ago) / US

Bennacer-tv-live.com (6 seconds ago) / US

Manuels.solutions (8 seconds ago) / US

Crochetsavedmylife.kathrynvercillo.com (1 seconds ago) / US

Ourbeautifuldesign.com (0 seconds ago) / US

Revoltschool.com (1 seconds ago) / US

Cre8tiveinteriors.co.uk (0 seconds ago) / US

7figureautomation.com (0 seconds ago) / US

Jacobandco.shop (12 seconds ago) / CA

Sdgslifestyle.com (6 seconds ago) / JP

Truedryrestoration.com (1 seconds ago) / US

Websites Listing

We found Websites Listing below when search with 7figureautomation.com on Search Engine

7 Figure Automation | LinkedIn

Web 7 Figure Automation helps business-to-business technology companies fill their sales pipeline so they can focus on closing deals. Our mission is to become the best …

Linkedin.com

7 Figure Automation Employment Application

Web 7 Figure Automation is a forward-thinking lead generation company that helps salespeople fill their sales pipeline, so they can focus on selling. Learn more here. Links Find us on …

P.7figureautomation.com

7 Figure Automation - Facebook

Web 7 Figure Automation. 1,904 likes. DOUBLE Infusionsoft Revenue: "7 Easy Ways To Double Infusionsoft Revenue". Get It Here: http://7figu 7 Figure Automation

Facebook.com

Sales Development Demo Request - 7 Figure Automation

Web Eliminate bad contact data and increase response rate Scale business development with smart messaging Fill your sales pipeline and eclipse quota every quarter We focus on …

M.7figureautomation.com

7 Figure Automation - Crunchbase Company Profile & Funding

Web Headquarters Regions Greater Boston Area, East Coast, New England Founded Date Jan 1, 2013 Operating Status Active Company Type For Profit Contact Email …

Crunchbase.com

What is 7 Figure Automation? Company Culture, Mission, Values

Web Revenue: Less than $1 million (USD) Competitors: Unknown. 7 Figure Automation is a forward-thinking sales development agency that helps salespeople fill their pipeline, so …

Glassdoor.ca

LinkedIn Lead Generation Playbook - m.7figureautomation.com

Web 10 LinkedIn message scripts to boost prospect engagement and profile views 3 personal connection request messages that doubled our acceptance rate 6 LinkedIn message …

M.7figureautomation.com

Sales Playbook Template - 7 Figure Automation

Web Use this playbook to document your company's sales plans, goals and resources. - Mark Marcelletti, CEO of 7 Figure Automation.

M.7figureautomation.com

Working at 7 Figure Automation | Glassdoor

Web 7 Figure Automation is a forward-thinking sales development agency that helps salespeople fill their pipeline, so they can focus on selling. We use Artificial Intelligence and Machine …

Glassdoor.com

Sales Development Demo Thanks - m.7figureautomation.com

Web Software and professional services companies use 7 Figure Automation to fill their sales pipeline and close more deals. Business Development Insights Every Week. Now that …

M.7figureautomation.com

7 Figure Automation Careers and Employment | Indeed.com

Web 7 Figure Automation uses Artificial Intelligence and Machine Learning technology to find companies that are searching for your solution. Our team of business development …

Indeed.com

7 Figure Automation Reviews 2023: Details, Pricing, & Features - G2

Web Jun 11, 2019  · 7 Figure Automation uses Artificial Intelligence to help salespeople generate pipeline and close more deals. We help you scale business growth with appointment …

G2.com


Domains Expiration Date Updated

Site Provider Expiration Date
nftsguru.com godaddy.com -3 Years, -284 Days
iptvwallet.biz namecheap.com -3 Years, -190 Days
blackbirdpublishing.com godaddy.com -2 Years, -241 Days
bookvilogger.com netowl.jp -3 Years, -143 Days
eccecouncil.org publicdomainregistry.com -3 Years, -233 Days
mayamu.asia godaddy.com -3 Years, -20 Days
seosmoothie.com domains.google.com -3 Years, -20 Days
hearspace.org melbourneit.com.au -3 Years, -306 Days
fullcirclevets.com namecheap.com -2 Years, -328 Days
tengtools.com ascio.com -3 Years, -112 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.2K domains   

    .net747.7K domains   

    .gov23.6K domains   

    .us47.8K domains   

    .ca62.9K domains   

    .de612K domains   

    .uk489.4K domains   

    .it56.5K domains   

    .au67.9K domains   

    .co56.1K domains   

    .biz19.4K domains   

    .info48.6K domains   

    .fr57.6K domains   

    .eu40.1K domains   

    .ru266K domains   

    .ph8.3K domains   

    .in85.2K domains   

    .vn25.7K domains   

    .cn85.1K domains   

    .ro28.2K domains   

    .ch23K domains   

    .at17.9K domains   

    Browser All