Distributors.ranpak.com


Keyword Suggestion

Distributors
Distributorship
Distributors meaning
Distributors near me
Distributors.hycite.com
Distributorship agreement
Distributors hycite login
Distributors rehlko
Distributors wholesale
Distributors list
Distributorship meaning
Distributors deutsch
Distributors price list
Distributors portal flowers bakeries
Distributors in dallas
Distributors in texas
Distributors in los angeles
Distributors inc hawaii
Distributors in chicago
Distributors in alabama
Distributors transport orlando fl
Distributors in arizona
Distributors in michigan
Distributors in florida
Distributors in georgia



Domain Informations

Network
  • inetnum : 54.224.0.0 - 54.255.255.255
  • name : AMAZON-2011L
  • handle : NET-54-224-0-0-1
  • status : Direct Allocation
  • created : 2011-12-08
  • changed : 2024-01-24
  • desc : -----BEGIN CERTIFICATE-----MIICljCCAX4CCQDvS1je1Bd4uzANBgkqhkiG9w0BAQsFADANMQswCQYDVQQGEwJVUzAeFw0yMDA4MjYxODQ1NThaFw0yMTA4MjYxODQ1NThaMA0xCzAJBgNVBAYTAlVTMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEA5geQJL7KoQhQLaTteXnFj0xsze15HgB9cpHPoL6khWVUthOg6AYCBHCcVJWeuEHuYGJcnrtW1tyLWpgfrxaw5E4ZtunSHElzO6BIp2u0215mbSGPQUt3TMR64nvXvEAY4qBP/p2+j0ud2eI47eA3s2ykFztEJPb7eZh8lVCGj5n2msRxeFiYwoB7/u3TDnW0/BwNLnJgyGkAWYUlk68hR10LHoBqGPezn7mPuiLHNa6JQP0WTYBz/80kS3m/4oZ7NS20PMieXqFjfYEgW6fPg7uJKhH3aYVVveZpBS5cRzm360HyT5hj1rUJh34nVCLMlvP+400w1wxr9buLnQzVlwIDAQABMA0GCSqGSIb3DQEBCwUAA4IBAQCZD7ERFb2LpeLdQgyji/ZqZ7lDXR8wq4m+ihMiqpPcwTVs1dfBfKDvZ4K6Ddyzkfd1NQYPWiV47nvqgJxwdISa7vN011RxBEGkYdJ8cNaRXW7aCGfQ8ZSQL6mbXsm4sbvDQNHiWJcdUB0KTzR/wpbXf9+24TbPGaOsZvfnKtd1lZhY5xFiOVCOdI59c/XyDH9aqOKNE0pOeATX55I3bU5PKeK5CM8oAtD2sFAQ956Uvj7/vFDs8QP3upzf53R+erSU10L1fTQBWHjNUCcf9wviS+U4hsaCcBZMlw6d5Q84GYX1tS+YwtA0Fv/NQcOWr9RJT+JVnpbyAxEyjI37XOqH-----END CERTIFICATE-----,All abuse reports MUST include:,* src IP,* dest IP (your IP),* dest port,* Accurate date/timestamp and timezone of activity,* Intensity/frequency (short log extracts),* Your contact details (phone and email) Without these we will be unable to identify the correct owner of the IP address at that point in time.
Owner
  • organization : Amazon Technologies Inc.
  • handle : AT-88-Z
  • address : Array,Seattle,WA,98109,US
Abuse
  • handle : AEA8-ARIN
  • name : Amazon EC2 Abuse
  • phone : +1-206-555-0000
  • email : [email protected]
Technical support
  • handle : ANO24-ARIN
  • name : Amazon EC2 Network Operations
  • phone : +1-206-555-0000
  • email : [email protected]
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 54.225.238.212
  • Location: Ashburn United States
  • Latitude: 39.0481
  • Longitude: -77.4728
  • Timezone: America/New_York

Check all domain's dns records


See Web Sites Hosted on 54.225.238.212

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 54.225.238.212)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 54.225.238.212)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with distributors.ranpak.com

Found 0 emails of this domain

Recent Searched Sites

Ca-cdc.ru (2 seconds ago) / RU

Gatehouse-games.crystalcommerce.com (2 seconds ago) / US

Dollcraftermarketplace.mysharetribe.com (3 seconds ago) / IE

Wildernessguidesnz.com (0 seconds ago) / NZ

Aromaticsherbs.com (4 seconds ago) / FR

Blog.mountvernonmantels.com (1 seconds ago) / US

Dpopro-update21.formacaoaep.eu (1 seconds ago) / US

Casl.tfaforms.net (3 seconds ago) / US

Vivirfrentealmar.tenantcloud.com (2 seconds ago) / US

Countengineering.co.uk (0 seconds ago) / GB

Xendach.de (2 seconds ago) / DE

Hustlr.com (2 seconds ago) / US

Ironagekoreansteakhouse.com (2 seconds ago) / US

Distributors.ranpak.com (1 seconds ago) / US

Fruitfuljobs.com (1 seconds ago) / GB

65.49.30.178 (3 seconds ago) / US

Novusbiostg.corpenttech.com (5 seconds ago) / US

Inventorsdigest.com (1 seconds ago) /

Gateau-cadeau.com (4 seconds ago) / US

Aussiespecialist.com (0 seconds ago) / US

Websites Listing

We found Websites Listing below when search with distributors.ranpak.com on Search Engine


Domains Expiration Date Updated

Site Provider Expiration Date
wypeuk.com godaddy.com -3 Years, -74 Days
nolabels.org whois.godaddy.com -3 Years, -4 Days
itacademycourses.com register.com -3 Years, -224 Days
matisse.net networksolutions.com -2 Years, -213 Days
fliwy.com namecheap.com -1 Years, -171 Days
nicholaskirkwood.com melbourneit.com.au 3 Years, 93 Days
petarenapro.com atakdomain.com -3 Years, -223 Days
nconl.org whois.godaddy.com -3 Years, -283 Days
elvisec.com networksolutions.com -3 Years, -13 Days
cotlakes.com godaddy.com -2 Years, -45 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.2K domains   

    .net747.4K domains   

    .gov23.6K domains   

    .us47.7K domains   

    .ca63K domains   

    .de612.1K domains   

    .uk489.4K domains   

    .it56.6K domains   

    .au67.9K domains   

    .co56K domains   

    .biz19.4K domains   

    .info48.5K domains   

    .fr57.6K domains   

    .eu40.1K domains   

    .ru266.1K domains   

    .ph8.3K domains   

    .in85K domains   

    .vn25.6K domains   

    .cn85.1K domains   

    .ro28.2K domains   

    .ch23K domains   

    .at18K domains   

    Browser All