Dpmgt.com


Keyword Suggestion

Dpmgt.com
Dpmg transparencia
Domgtrav
Dongtan dress
Dong thap
Dongtaiwang
Dongtan korea
Dongtan style
Dongten vietnam
Dongting lake
Dongtoico14
Dongtan beach



Domain Informations

Dpmgt.com lookup results from whois.networksolutions.com server:
  • Domain created: 1998-03-25T05:00:00Z
  • Domain updated: 2018-03-24T10:24:48Z
  • Domain expires: 2028-03-24T04:00:00Z 2 Years, 77 Days left
  • Website age: 27 Years, 287 Days
  • Registrar Domain ID: 1416984_DOMAIN_COM-VRSN
  • Registrar Url: http://networksolutions.com
  • Registrar WHOIS Server: whois.networksolutions.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: +1.8777228662
  • Name server:
    • NS75.WORLDNIC.COM
    • NS76.WORLDNIC.COM

Network
  • inetnum : 23.236.48.0 - 23.236.63.255
  • name : GOOGLE-CLOUD
  • handle : NET-23-236-48-0-1
  • status : Direct Allocation
  • created : 2006-09-29
  • changed : 2019-11-01
  • desc : ** The IP addresses under this netblock are in use by Google Cloud customers **,Direct all copyright and legal complaints to,https://support.google.com/legal/go/report,Direct all spam and abuse complaints to,https://support.google.com/code/go/gce_abuse_report,For fastest response, use the relevant forms above.,Complaints can also be sent to the GC Abuse desk,([email protected]),but may have longer turnaround times.,Complaints sent to any other POC will be ignored.,*** The IP addresses under this Org-ID are in use by Google Cloud customers ***,Direct all copyright and legal complaints to,https://support.google.com/legal/go/report,Direct all spam and abuse complaints to,https://support.google.com/code/go/gce_abuse_report,For fastest response, use the relevant forms above.,Complaints can also be sent to the GC Abuse desk,([email protected]),but may have longer turnaround times.,Complaints sent to any other POC will be ignored.
Owner
  • organization : Google LLC
  • handle : GOOGL-2
  • address : Array,Mountain View,CA,94043,US
Abuse
Technical support
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 23.236.62.147
  • Location: Mountain View United States
  • Latitude: 37.4043
  • Longitude: -122.0748
  • Timezone: America/Los_Angeles

Check all domain's dns records


See Web Sites Hosted on 23.236.62.147

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 23.236.62.147)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 23.236.62.147)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with dpmgt.com

Found 3 emails of this domain
1. [email protected]
2. [email protected]
3. [email protected]

Recent Searched Sites

Asitayaruo.com (3 seconds ago) / JP

Articles.ricardogriffith.com (2 seconds ago) /

Crochetsavedmylife.kathrynvercillo.com (2 seconds ago) / US

Aspenpropertymgmt.com (0 seconds ago) / US

Demichem.com (6 seconds ago) / AR

Allchurchsound.com (5 seconds ago) / US

Genexlabco.ir (0 seconds ago) / IR

Mondiawatches.com (2 seconds ago) / IT

Go-ahead-healthy.com (2 seconds ago) / US

Vapnex.com (0 seconds ago) / DE

Buckmasterart.com (0 seconds ago) / US

Sportsnomori.com (0 seconds ago) / JP

Pa-wholesale.com (2 seconds ago) / US

Monster-air.com (10 seconds ago) / CN

Tmwlandscapemanagement.com (0 seconds ago) / BG

Mariescountymo.gov (2 seconds ago) / US

Ladbrokes.webformregistration.com (6 seconds ago) / IE

Whzhzl.com (24 seconds ago) / ZA

Auscompliancelab.com (8 seconds ago) / AU

Dpmgt.com (0 seconds ago) / US

Websites Listing

We found Websites Listing below when search with dpmgt.com on Search Engine

Commercial Real Estate | 333 N Bedford Rd - dpmgt

ABOUT US. Diamond Properties is a commercial real estate business located in Mount Kisco, New York that focuses on the acquisition of commercial properties with potential for substantial improvement through hands-on property …

Dpmgt.com

Building Loyalty Program | Diamond Properties - dpmgt

If you have questions, please email us at [email protected]. Thank you for being a loyal Diamond Properties tenant! Success! Message received. Submit. CURRENT OFFERS. To participate, you must be an employee of a company leasing space from Diamond Properties. Brew & Co. Our friendly staff is passionate and knowledgeable about craft beer, and we love …

Dpmgt.com

About | Diamond Property Management - dpmgt

Since Diamond Properties was founded in 1993, we have acquired over 67 properties, including office, warehouse, retail, residential, and land in 7 states totaling in excess of 11 million square feet. We continue to pursue an intense capital improvement and leasing program that, when combined with quality-driven customer service, has enabled us ...

Dpmgt.com

Forms - DPM Management

Rental Application ‐Tenant. Property Management Application ‐Landlord. Pre‐Authorized Debit form ‐rental ‐ PAD. Non‐resident form ‐ NR6. Tenant information form ‐ Form K.

Dpmmanagement.ca

Explore Our Online Commercial Real Estate Portal

Email. Password. Enter your login. Don't have an account? Sign Up Forgot Password? Powered By . CrowdStreet Connect ...

Invest.dpmgt.com

CONTACT US - Kirby Hill Farm

We hope you’ll visit us for the full Kirby Hill experience. If you’d like more information on boarding your horse, lessons and training please contact Paul Kuhn at 914-519-7985 or e-mail [email protected]. To inquire about Kirby Hill Farm Beef or events please e-mail [email protected].

Kirbyhillfarm.com

Rentals - DPM Management

DPM Rental Management’s property managers are fully licensed and insured under the Real Estate Act of B.C. and receive regular training. DPM is a company registered under the Companies Act of the Province of B.C. and is licensed and insured as required by the Real Estate Council. RATES. Contact Jason Heukelom at 604-982-7065 for a quote.

Dpmmanagement.ca

HOME | D.P. Management

[email protected]. HOME. CONTACT. More. O-1B, P1 & P3 Performing Artists Work Visas for U.S. For performers planning to tour and work in the United States, D.P. Management can help you obtain your work visas. Experienced, Straightforward, Affordable Guidance ...

Dpworkvisa.com

Diamond Properties Information | Diamond Properties Profile

Description For information on current space availabilities call Mark Blandford at 914-773-6242 or email [email protected] Specialties Medical Office Mount Kisco, Warehouse Space Mount Kisco, Westchester Office Space, Westchester Real Estate, Stamford Medical Office Space, Westchester Retail Space, Cincinatti Office Space, Westchester Flex Space View Top …

Rocketreach.co

Dpmgt | B2B DB

John Busey Wood - The Commercial Real Estate Resource. leasingnyc.com. See more

B2b.io

dmgt.com Free Email Domain Validation | MailboxValidator

MailboxValidator Email Domain Validation is a free domain name validation through domain mail server to determine the email domain server status, MX records, DNS records and so on. This simple demo performs a quick check to see if an email domain is valid and responding. If you would like to perform a comprehensive email validation, please try the

Mailboxvalidator.com

The DMGT

2022-04-02  · The Podcast. Digital lifestyle and opinions on everything from Spencer & Danny, as well as the occasional guest. New episodes every Wednesday.

Thedmgt.com

Get in Touch | Group Insurance Benefits - GPM

1 866.967.7737. T 450.667.7737 . F 450.667.7739. [email protected]

Gpm.ca

TPMG - The Property Management Group - Contact Us

TPMG Capital. 9th Floor - 999 West Broadway. Vancouver, B.C. V5Z 1K5

Tpmgcapital.com

Lingnan University

2022-04-06  · Email: [email protected] Address: SEK102/2, 1/F, Simon and Eleanor Kwok Building, Lingnan University, Tuen Mun, Hong Kong . Master of Science in Human Resource Management and Organisational Behaviour Programme. Tel: (852) 2616 8308 / 2616 8309 Fax: (852) 2467 0982 Email: [email protected]

Ln.edu.hk

Pmgt Gestão Simplificada email format | Pmgt Gestão ...

[email protected] (firstname).(l) john.dpmgt.com.br (lastname) [email protected] (lastname).(firstname) [email protected] (f).(lastname) [email protected] (f)(l) [email protected] (l)(f) [email protected] Pmgt Gestão Simplificada Information Email formats, Phone Number, CEO CTO CFO COO CMO email of Pmgt Gestão Simplificada Location: Sao Luis, Maranhao, …

Aeroleads.com

Dpmgt

Dpmgt

Facebook.com

DPMT Meanings | What Does DPMT Stand For?

What does DPMT abbreviation stand for? List of 15 best DPMT meaning forms based on popularity. Most common DPMT abbreviation full forms updated in March 2022

Allacronyms.com

dpmgt.com - prodomain.info

SEO - Alexa Traffic Ranks (Average of last 30 days) SEO Global Rank: SEO Reach Rank: Country: SEO Rank in Country: Last Update: Global Rank Trend of The Past Year

Prodomain.info

DPMG Meanings | What Does DPMG Stand For?

What does DPMG abbreviation stand for? List of 12 best DPMG meaning forms based on popularity. Most common DPMG abbreviation full forms updated in March 2022

Allacronyms.com


Domains Expiration Date Updated

Site Provider Expiration Date
mantraayurveda.com godaddy.com -2 Years, -5 Days
efcug.com internet.bs -3 Years, -249 Days
pphub5.com namesilo.com -2 Years, -354 Days
simpsp.com meshdigital.com -3 Years, -188 Days
colemanfarmstownhomes.com godaddy.com -2 Years, -257 Days
haitang123.co namesilo.com -3 Years, -102 Days
noticieroandroid.com namecheap.com -3 Years, -293 Days
eveningg.cc namecheap.com -3 Years, -285 Days
casaeplanos.com namecheap.com -3 Years, -148 Days
xishici.com ename.net -3 Years, -280 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.2K domains   

    .net746.8K domains   

    .gov23.6K domains   

    .us47.6K domains   

    .ca63K domains   

    .de612.2K domains   

    .uk489.4K domains   

    .it56.6K domains   

    .au67.9K domains   

    .co55.8K domains   

    .biz19.4K domains   

    .info48.4K domains   

    .fr57.6K domains   

    .eu40.1K domains   

    .ru265.9K domains   

    .ph8.3K domains   

    .in84.8K domains   

    .vn25.6K domains   

    .cn85.2K domains   

    .ro28.2K domains   

    .ch23K domains   

    .at18K domains   

    Browser All