Emergency.athabascau.ca


Keyword Suggestion

Emergency
Emergency reporting
Emergency contact form
Emergency vet near me
Emergency room
Emergency kit
Emergency preparedness
Emergency dentist near me
Emergency car repair
Emergency tv show
Emergency management
Emergency dental near me
Emergency action plan
Emergency nurses association
Emergency roof repair near me
Emergency reporting login
Emergency room near me
Emergency networking fire reporting
Emergency exit
Emergency 4 mods
Emergency dispatch
Emergency broadcast system
Emergency stop
Emergency lighting system
Emergency hq



Domain Informations

Network
  • inetnum : 44.224.0.0 - 44.255.255.255
  • name : AMAZO-ZPDX
  • handle : NET-44-224-0-0-1
  • status : Reallocated
  • created : 2011-05-10
  • changed : 2021-07-22
Owner
  • organization : Amazon.com, Inc.
  • handle : AMAZO-47
  • address : Array,Seattle,WA,98144,US
Technical support
  • handle : ANO24-ARIN
  • name : Amazon EC2 Network Operations
  • phone : +1-206-555-0000
  • email : [email protected]
Abuse
  • handle : AEA8-ARIN
  • name : Amazon EC2 Abuse
  • phone : +1-206-555-0000
  • email : [email protected]
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 44.236.159.244
  • Location: Boardman United States
  • Latitude: 45.8491
  • Longitude: -119.7143
  • Timezone: America/Los_Angeles

Check all domain's dns records


See Web Sites Hosted on 44.236.159.244

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 44.236.159.244)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 44.236.159.244)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with emergency.athabascau.ca

Found 0 emails of this domain

Recent Searched Sites

Virusis.com (0 seconds ago) / US

Ducksmilitaryframesandstickers.webstoreplace.com (15 seconds ago) / US

Uv-fixture.com (4 seconds ago) / US

Longbeachnature.com.tr (8 seconds ago) / TR

Jeewansooriyaarachchi.medium.com (11 seconds ago) /

Webtech-inc.com (5 seconds ago) / US

Cnssystems.se (8 seconds ago) / DK

Fastonboarding.com (7 seconds ago) / PL

64.150.188.11 (10 seconds ago) / US

Pro.plugwine.com (0 seconds ago) / US

Green-mercury.com (1 seconds ago) / DE

Examesindor.com.br (6 seconds ago) / US

Zanasi.net (6 seconds ago) / GB

Ayur-beauty.com (3 seconds ago) / JP

Emergency.athabascau.ca (0 seconds ago) / US

Bazcorp.com (1 seconds ago) / ID

Wsucougarsstore.com (0 seconds ago) / US

Mandalikapost.com (9 seconds ago) / MX

Rn-card.ru (7 seconds ago) / RU

Stehlikes.aldineisd.org (2 seconds ago) / US

Websites Listing

We found Websites Listing below when search with emergency.athabascau.ca on Search Engine

Emergency bursaries available | Athabasca University

2022-01-20  · $1,000 bursaries available. Bursaries valued at $1,000 each will be available to undergraduate, graduate, and non-program learners at AU via the AU Graduate Student Emergency Bursary, the AU Undergraduate Student Emergency Bursary, and the AU Open Studies Emergency Bursary.. Applications will be open until Feb. 4, 2022, or until the pool of …

News.athabascau.ca

Login - Athabasca University

Login. IT Service Notice. SYSTEM MAINTENANCE. MyAU, Books 24x7, and some other sites may be inaccessible for up to 5 minutes at a time on Monday, May 2 from 11:00 pm - midnight. Please plan your work around this time. We apologize for the inconvenience. Readmore.

Login.athabascau.ca

Email the President | Office of the President | Athabasca ...

Contact the Athabasca University President Neil Fassina.

Www-preview.athabascau.ca

Sign in to AUSpace - Athabasca University

Register an account to subscribe to collections for email updates, and submit new items to AUSpace. Click here to register. Athabasca University Library & Scholarly Resources

Auspace.athabascau.ca

Login - Athabasca University

Watchman and ToolsELab (film, media.lib, openstudios.athabascau.ca; unescochair.athabascau.ca; tekri.athabascau.ca; e-lab.ca and tools.elab.athabascau.ca and related sites) will be inaccessible on Thursday, April 28 from 9:00 am - 1:30 pm. Please plan your work around this time. We apologize for the inconvenience. Student ID or Staff U sername: P …

Lumptl.athabascau.ca

New emergency bursaries available - The Hub Announcements

2021-02-10  · Now, recognizing the ongoing impact of the pandemic, AU has reopened the applications for the Emergency Relief Fund for learners in our community who continue to face financial burden due to the pandemic. Bursary applications will open Feb. 19 at 8:30 a.m. and close Feb. 28 at 11:59 p.m., 2021 (MST). The fund will provide a $1,000 bursary to ...

News.athabascau.ca

Forgot Password - Athabasca University

Reset Password. →. Finished. Enter the email address you provided when you registered with AUSpace. An email will be sent to that address with further instructions. Email Address: Enter the same address used when registering. Athabasca University Library & Scholarly Resources. Phone: (800) 788-9041 ext 6254 | Email: [email protected].

Auspace.athabascau.ca

emergency bursary Archives - The Hub - Athabasca University

The Hub emergency bursary. Notification. No updates currently. Search. Search for: Home Page; COVID-19; Learners; Alumni; PowerED; Events; Get Social; Words to the Wise; In Our Communities; Announcements ; Research; Faculty. Faculty of Business; Faculty of Graduate Studies; Faculty of Health Disciplines; Faculty of Humanities and Social Sciences; Faculty of …

News.athabascau.ca

Login - vshare.athabascau.ca

Chrome River and SRM 1.1, SRM 2.2, SRM portal (scc.athabascau.ca) will be inaccessible on Thursday, April 21 from 4:30pm - 7:30pm. Please plan your work around this time. We apologize for the inconvenience.

Vshare.athabascau.ca

Grades

Grades

Grades.athabascau.ca

B.C. floods: Important information ... - news.athabascau.ca

2021-11-17  · AU Information Centre. For more information on the above disaster contingencies for learners, please contact our Information Centre by phone during business hours, Monday to Friday from 9 a.m. to 4 p.m. (MT) or by email. Toll-free (Canada / U.S.): 1-800-788-9041. International: 1-780-675-6100. Email: [email protected].

News.athabascau.ca

Forgotten password - Athabasca University

To reset your password, submit your username or your email address below. If we can find you in the database, an email will be sent to your email address, with instructions how to get access again. Search by username. Username Search by email address. Email address Home. Mental Health & Wellness. Research. Library. AU Store . Alumni. News. Open, Flexible, and …

Ocw.lms.athabascau.ca

Wildfires: Important information for learners - The Hub

2021-08-06  · AU Information Centre. For more information on the above disaster contingencies for learners, please contact our Information Centre by phone during business hours, Monday to Friday from 10 a.m. to noon and 1 to 3 p.m. (MT) or by email. Toll-free (Canada / U.S.): 1-800-788-9041. International: 1-780-675-6100. Email: [email protected].

News.athabascau.ca

Office of the Registrar Online Services - Athabasca University

If you have any questions about the collection and use of this information, contact, Coordinator, Registration Services, Athabasca University, 1 University Drive, Athabasca, AB Canada T9S 3A3 Telephone: 780.675.6100.

Tux.athabascau.ca

Athabasca University - www-preview.athabascau.ca

Athabasca University's Center for Science (AUCS) is committed to providing a healthy, safe, and environmentally responsible workplace and learning environment for its staff and students.

Www-preview.athabascau.ca

The Landing: Log in - Athabasca University

The Landing is a social site for Athabasca University staff, students and invited guests. It is a space where they can share, communicate and connect with anyone or everyone. Unless you are logged in, you will only be able to see the fraction of posts on the site that have been made public. Right now you are not logged in.

Landing.athabascau.ca

The Landing: Posts tagged with: email - landing.athabascau.ca

The Landing sends two sorts of notification: email (self-explanatory) web (sent to your Messages inbox on the Landing) You can turn any or all of them off, as well as control some aspects of when they are sent (e.g. whether or not they are... Public; History; Notifications - turning email and web alerts on and off . Last updated September 21, 2010 - 11:09am by Terry Anderson. …

Landing.athabascau.ca

Digital Reading Room 2.0 - drr2.lib.athabascau.ca

Building an emergency plan: A guide for museums and other cultural institutions. Los Angeles: The Getty Conservation Institute. Please read. Chapter 2: The Role of the Director Chapter 3: The Role of the Emergency Preparedness Manager and the Emergency Preparedness Committee Chapter 4: Communications Chapter 5: Training. Kahn, M. B. (2012).

Drr2.lib.athabascau.ca

eos.athabascau.ca

AUTUMNX magnetometer network is funded through the Canadian Space Agency / Geospace Observatory (GO) Canada program Athabasca University, Centre for Science / Faculty of Science and Technology, 2014

Eos.athabascau.ca

Support Services - www-preview.athabascau.ca

AU Canada's Online University. Athabasca University respectfully acknowledges that we live and work on the traditional lands of the Indigenous Peoples of Canada (First Nations, Inuit, Métis). We honour the ancestry, heritage, and gifts of the Indigenous Peoples and give thanks to them. A-Z index. Careers. Undergraduate Calendar. Graduate Calendar.

Www-preview.athabascau.ca


Domains Expiration Date Updated

Site Provider Expiration Date
mangaraw.co namesilo.com -3 Years, -4 Days
libertyparkgrill.com wildwestdomains.com -3 Years, -337 Days
mindset-psychology.net key-systems.net -3 Years, -91 Days
manisahotel.com ovh.com -3 Years, -191 Days
brickhousekc.com godaddy.com 314 Days
deshiosadiya.com godaddy.com -2 Years, -82 Days
tokuflix.com domains.google.com -4 Years, -31 Days
kinaru.com jprs.jp -3 Years, -85 Days
im5tu.io 1api.net -2 Years, -107 Days
oplakias.com onlinenic.com -3 Years, -144 Days

    Browser All

    .com6.6M domains   

    .org1.1M domains   

    .edu63.5K domains   

    .net749.6K domains   

    .gov24.8K domains   

    .us48.4K domains   

    .ca68.5K domains   

    .de615.6K domains   

    .uk491.4K domains   

    .it58.3K domains   

    .au69.5K domains   

    .co56.6K domains   

    .biz19.4K domains   

    .info48.6K domains   

    .fr59.9K domains   

    .eu40.8K domains   

    .ru266.7K domains   

    .ph8.5K domains   

    .in85.6K domains   

    .vn25.7K domains   

    .cn85.6K domains   

    .ro28.6K domains   

    .ch23.7K domains   

    .at18.5K domains   

    Browser All