Henrymatthewsdds.com


Keyword Suggestion

Henry matthews dds
Henry matthews dds fayetteville ar



Domain Informations

Henrymatthewsdds.com lookup results from whois.godaddy.com server:
  • Domain created: 2011-05-27T14:34:55Z
  • Domain updated: 2023-05-31T19:12:17Z
  • Domain expires: 2025-05-27T14:34:55Z 1 Year, 37 Days left
  • Website age: 12 Years, 328 Days
  • Registrar Domain ID: 1658434634_DOMAIN_COM-VRSN
  • Registrar Url: http://www.godaddy.com
  • Registrar WHOIS Server: whois.godaddy.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: 480-624-2505
  • Name server:
    • NS77.DOMAINCONTROL.COM
    • NS78.DOMAINCONTROL.COM

Network
  • inetnum : 15.196.0.0 - 15.200.255.255
  • name : AT-88-Z
  • handle : NET-15-196-0-0-1
  • status : Direct Allocation
  • created : 2011-12-08
  • changed : 2024-01-24
  • desc : -----BEGIN CERTIFICATE-----MIIDnjCCAoYCCQCMCXLBuibPpjANBgkqhkiG9w0BAQsFADCBkDELMAkGA1UEBhMCVVMxCzAJBgNVBAgMAldBMRAwDgYDVQQHDAdTZWF0dGxlMQwwCgYDVQQKDANBV1MxETAPBgNVBAsMCElkZW50aXR5MRMwEQYDVQQDDApzaWduaW4uYXdzMSwwKgYJKoZIhvcNAQkBFh1hd3MtaWQtc2lnbmluLWNvcmVAYW1hem9uLmNvbTAeFw0yMjA0MjExODEyNDdaFw0yMzA0MjExODEyNDdaMIGQMQswCQYDVQQGEwJVUzELMAkGA1UECAwCV0ExEDAOBgNVBAcMB1NlYXR0bGUxDDAKBgNVBAoMA0FXUzERMA8GA1UECwwISWRlbnRpdHkxEzARBgNVBAMMCnNpZ25pbi5hd3MxLDAqBgkqhkiG9w0BCQEWHWF3cy1pZC1zaWduaW4tY29yZUBhbWF6b24uY29tMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEA2OLoxduBX+OJYYmeN1V9WSrohqUuzLeEsRA5TTgyx9IA2rSh8LyoTXiyrlMJfIGO/OE1VOjLMDUXQVoz/YO/CNIss6Iw/NZtLn14RIW/iQ4rS3O+G/ZF91v9IVdiwtPc59mhZfw/vBm/L7zgWJCEMVg/tM04EHmZEOZuodnrjoyPEPihI8qI+PzSYu3JBsZXat8aC7EPmyEcUVfXXu8dcaHm6REbEuB6WU4vCbe303zy9KoA9xbMebr6Hw9Ao/UTTGhAc1tJQD4HdPZwJmt5RMlyEa3jKyEu+YDZrx8Ci617h4KnB3uzOsmjmtbKrErDiw5bluJrZw7Vp2uzxirolQIDAQABMA0GCSqGSIb3DQEBCwUAA4IBAQDYtJyOoj1fUOYjwLyELQnPAfo06/42rktqMOk+bLGK2BYHQzvxFlyBmNl5FzawvOa/auKySgG5ISO7lu29HUMAhIOkD55JWcZu/jkxFFdccQnoezBbVKyEiOfFQJfAgmrNnHlEL587ROO+L+yfAEnJ7BgyBzzzWbaQZhdJd2zHrhAL1cVvQbdXqVPUnFti7A9DfBJ9rQ4GqyIN963AuOHpiberNJbj1ZqNFx72Y4fHAsBRtMdXkG+pxzPnQt5lurfsSFVnVwDr+/Cm1Rx1EyEwjuXZlem1hQb0olALWKtxbh9pyuP5SP1TdHWyI9EA9Y60dPpqGdL0N5nGmUJ7b2Ka-----END CERTIFICATE-----,All abuse reports MUST include:,* src IP,* dest IP (your IP),* dest port,* Accurate date/timestamp and timezone of activity,* Intensity/frequency (short log extracts),* Your contact details (phone and email) Without these we will be unable to identify the correct owner of the IP address at that point in time.
Owner
  • organization : Amazon Technologies Inc.
  • handle : AT-88-Z
  • address : Array,Seattle,WA,98109,US
Technical support
  • handle : ANO24-ARIN
  • name : Amazon EC2 Network Operations
  • phone : +1-206-555-0000
  • email : [email protected]
Abuse
  • handle : AEA8-ARIN
  • name : Amazon EC2 Abuse
  • phone : +1-206-555-0000
  • email : [email protected]
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 15.197.142.173
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 15.197.142.173

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 15.197.142.173)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 15.197.142.173)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with henrymatthewsdds.com

Found 1 emails of this domain
1. [email protected]

Recent Searched Sites

En.pisco.com.vn (1 mins ago) / VN

Comdinheiro.com.br (2 seconds ago) / US

Sarnianewstoday.ca (6 seconds ago) / CA

Hoteldomusmearome.com (10 seconds ago) / US

Henrymatthewsdds.com (0 seconds ago) / US

Prodej-zabradli.cz (1 mins ago) / CZ

Jacksonvilletraveler.com (43 seconds ago) / US

Tlp.law (31 seconds ago) / US

Capitalfm.com (40 seconds ago) / GB

Daleandassociates.net (1 seconds ago) / US

8xber.com (8 seconds ago) / US

Fulico.co (4 seconds ago) / CA

Hmregla.com (9 seconds ago) / NL

Homefont.cn (4 seconds ago) / CN

Fir.singidunum.ac.rs (42 seconds ago) / US

Imei.unlockboot.com (1 seconds ago) / US

Beenar.net (10 seconds ago) / US

Honda.mandataire-auto-neuve.fr (36 seconds ago) / US

Okscreen.health.ok.gov (5 seconds ago) / US

Renown.org (7 seconds ago) / US

Websites Listing

We found Websites Listing below when search with henrymatthewsdds.com on Search Engine

Contact Henry Matthews, DDS | Henry Matthews DDS

Contact Us. Come to our Office: 1874 N. Hunters Ridge, Fayetteville, AR 72701. Call Us: 479.444.0339. Email Us: Have a general inquiry? Fill out the form below. and we will answer your questions as soon as possible.

Henrymatthewsdds.com

Dental Office Fayetteville AR | Henry Matthews DDS

Dr. Henry “Hank” Matthews. Dr. Matthews has been in private practice since 1987. He received his Bachelor’s degree in chemistry from the University of …

Henrymatthewsdds.com

Henry Matthews DDS - Dental clinic in Fayetteville, AR

Henry Matthews DDS | 1874 Hunters Rdg 2 Fayetteville AR 72701 | (479) 444-0339. Henry Matthews DDS. home; contact; Our Staff; Henry Matthews DDS. 1874 Hunters Rdg 2 …

Henrymatthewsddsfayetteville.com

Dental Insurance | Henry Matthews DDS

Henry Matthews, DDS files dental insurance claims for you to help you get the most of your dental insurance benefits. Pages Menu. Home; Meet Us; Services; Insurance; Photo Gallery; Online …

Henrymatthewsdds.com

Blog | Henry Matthews DDS

Five Dental Hygiene Tips for Diabetics. Posted by hmatthews on 3:26 pm in Blog | 0 comments. Diabetes is a metabolic disease where a person has chronic high blood sugar, and this can …

Henrymatthewsdds.com

Contact | Fayetteville, AR | Henry Matthews DDS

Henry Matthews DDS, Dental clinic in Fayetteville, AR, , 4794440339. Henry Matthews DDS | 1874 Hunters Rdg 2 Fayetteville AR 72701 | (479) 444-0339. Henry Matthews DDS. home; …

Henrymatthewsddsfayetteville.com

Contact Henry Matthews

Welcome to fill in the form below and I will contact you as soon as possible

Henrymatthews.com

Our Staff - henrymatthewsddsfayetteville.com

Our Staff. Evan Johnson, D.D.S. Dr. Evan Johnson joined the practice of Henry Matthews, D.D.S. in July of 2021. He earned his Bachelor of Science degree in Biology from the …

Henrymatthewsddsfayetteville.com

Henry Matthews, DDS - Accueil | Facebook

Henry Matthews, DDS, Fayetteville. 427 mentions J’aime · 47 personnes étaient ici. Henry Matthews DDS, located in Fayetteville, Arkansas, is a dentist office offering preventive, …

Fr-ca.facebook.com

Henry Matthews, DDS - Posts | Facebook

Henry Matthews DDS, located in Fayetteville, Arkansas, is a dentist office offering preventive,... 1874 Hunters Rdg, 2, Fayetteville, AR 72701

Facebook.com

Henry Matthews, DDS - Home | Facebook

Henry Matthews, DDS, Fayetteville. 427 likes · 47 were here. Henry Matthews DDS, located in Fayetteville, Arkansas, is a dentist office offering...

En-gb.facebook.com

Henry Matthews, DDS - Reviews | Facebook

Henry Matthews, DDS, Fayetteville. 427 likes · 48 were here. Henry Matthews DDS, located in Fayetteville, Arkansas, is a dentist office offering preventive, restorative, and cosmetic …

Facebook.com

Henry Matthews DDS - Fayetteville, AR - Company Information

Henry Matthews DDS, located in Fayetteville, Arkansas, is a dentist office offering preventive, restorative, and cosmetic dentistry. We provide a gentle touch and offer sedation dentistry for …

Dandb.com

henrymatthewsdds.com - Worth and traffic estimation | Cosmetic ...

Henrymatthewsdds.com is not currently ranked anywhere. henrymatthewsdds.com was launched at May 27, 2011 and is 10 years and 355 days. It reaches roughly 30 users and …

Statshow.com

Henry Matthews Architectural Historian Books Lectures

We spent inspiring nights in Agamemnon’s throne room at Mycenae, beside the sacred way at Delphi, among fallen columns of Olympia and in the remote Temple of Apollo at Bassae. …

Henrymatthews.com

HENRY MATTHEWS, DDS - 18 Photos - Cosmetic Dentists - 1874 …

Specialties: Henry Matthews DDS, located in Fayetteville, Arkansas, is a dentist office offering preventive, restorative, and cosmetic dentistry. We provide a gentle touch and offer sedation …

Yelp.ca

henrymatthewsdds.com Reviews, Rating 3. Read About …

Read 1 Review on henrymatthewsdds.com customer service and products. Submit your review or complaint. Smart.Reviews Categories For Businesses Browse Categories. Arts & …

Smart.reviews

Biography Henry Matthews

Contact by email. Website www.henrymatthews.com. Born in England 1935; Father: Edgar Matthews teacher at Haileybury College; theatre producer; Mother: Molly Carrington, actress, …

Henrymatthews.com

henrymatthewsdds.com Webrate website statistics and online tools

2021-05-08  · The last verification results, performed on (May 08, 2021) henrymatthewsdds.com show that henrymatthewsdds.com has an invalid SSL certificate. Click “Refresh” button for …

Webrate.org

Henry V. Matthews, DDS - Dentist in Fayetteville, AR - 72701 - 479 …

2020-10-16  · At Henry V. Matthews, DDS we strive to provide our patients with the best and most complete dental care. Our doctors and staff frequently attend continuing education …

Patientconnect365.com


Domains Expiration Date Updated

Site Provider Expiration Date
oasis.ca webnames.ca 183 Days
aspirefertility.in godaddy.com -1 Years, -47 Days
dmzshequ.com godaddy.com -1 Years, -312 Days
polaseklaw.com register.com -1 Years, -80 Days
cbelab.org registrar.amazon.com 4 Years, 110 Days
kaleidorolls.com meshdigital.com -1 Years, -256 Days
storeopinion-ca.info namecheap.com -1 Years, -130 Days
fertifa.com godaddy.com -1 Years, -315 Days
otor200sa.com name.com -2 Years, -8 Days
comeaux.com networksolutions.com 3 Years, 12 Days

    Browser All

    .com4.3M domains   

    .org1M domains   

    .edu40.9K domains   

    .net607.2K domains   

    .gov15.9K domains   

    .us31.2K domains   

    .ca44.9K domains   

    .de556.6K domains   

    .uk465.9K domains   

    .it34.4K domains   

    .au46.4K domains   

    .co33.9K domains   

    .biz13.9K domains   

    .info36.7K domains   

    .fr37.2K domains   

    .eu24.6K domains   

    .ru193.6K domains   

    .ph5.6K domains   

    .in54.2K domains   

    .vn18.8K domains   

    .cn39.8K domains   

    .ro19.3K domains   

    .ch11.5K domains   

    .at10.2K domains   

    Browser All