Logs.ovh.com


Keyword Suggestion

Logs
Logseq
Logstash
Logs legal group llp
Logscale
Logseq download
Logs wow
Logsheet monitoring
Logs for sale
Logs osrs
Logs math
Logstat
Logs legal group
Logspace matlab
Logs meaning
Logseq vs obsidian
Logscout
Logsdon office supply
Logspace
Logsdon and co
Logshark
Logsoft
Logs windows
Logstash documentation
Logs icon



Domain Informations

Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 51.38.195.94
  • Location: France
  • Latitude: 48.8582
  • Longitude: 2.3387
  • Timezone: Europe/Paris

Check all domain's dns records


See Web Sites Hosted on 51.38.195.94

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 51.38.195.94)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 51.38.195.94)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with logs.ovh.com

Found 0 emails of this domain

Recent Searched Sites

Color-personality-test.net (2 seconds ago) / US

Theushuaiaexperience.com (1 seconds ago) / US

Logs.ovh.com (1 seconds ago) / FR

Dollcraftermarketplace.mysharetribe.com (0 seconds ago) / IE

The-carriage-house-buffet-of-jefferson.bartgrocerybbq.com (1 seconds ago) / US

Portlandtattooco.com (0 seconds ago) / US

Androidfaithful.com (9 seconds ago) / NL

Gaia-gives.org (3 seconds ago) / DE

Kakounosusume.com (2 seconds ago) / US

Eactivities.imperialcollegeunion.org (6 seconds ago) / GB

Kaigo.rakuraku.or.jp (3 seconds ago) / JP

Shizuoka-shidashi.com (3 seconds ago) / US

Calvaryfullertonespanol.org (2 seconds ago) / US

Adg-europe.com (4 seconds ago) / DE

Topodati.lv (8 seconds ago) / LV

Claims.prolind-group.com (1 seconds ago) / SG

Gofuelsales.com (0 seconds ago) / US

Kinzelka.ru (0 seconds ago) / RU

Dhb.com.cn (0 seconds ago) / CN

Nmicr.ru (0 seconds ago) / RU

Websites Listing

We found Websites Listing below when search with logs.ovh.com on Search Engine

Log in to Webmail - OVHcloud

Exchange from OVH. Migrate easily and for free! More info . Why choose OVH? Accessibility for your emails. Access your emails from anywhere, on any device (computer, smartphone, tablet, etc.) on your web browser or email client. …

Ovh.com

Getting started with an OVHcloud email solution | OVH …

Go to the Webmail login page, then enter the email address and password. Then click the Login button. When you first log in to webmail, you will be prompted to set the interface language, and the time zone you are in. Your inbox will then appear. To find out how to use your email address via OWA webmail, you can refer to our Outlook Web App ...

Docs.ovh.com

OVH Webmail, Roundcube login

To log in you must enter your email address and your password in the field in the middle of the page. You will then be redirected to Roundcube which is the webmail software used by OVH.

Unipile.com

Roundcube Webmail 1.4.13 :: Welcome to Roundcube ... - OVH

Welcome to Roundcube Webmail 1.4.13. Username: Password: Login

Mail.ovh.net

Log in to Webmail - OVHcloud

The most comprehensive professional email solution, with data hosted in Europe. Ideal for: For start-ups, VSBs or SMEs. Get started. Private Exchange 2019 . All the most popular features of professional email solutions, hosted on your own virtual private server. Ideal for: SMEs and large enterprises . Get started. Why choose OVH? Accessibility for your emails. Access your emails …

Ovh.co.uk

Sign In - OVHcloud

This email address could not be used. Please check your email address and try again.

Us.ovhcloud.com

Permission to access your account - OVHcloud

Create an OVHcloud account to: Manage your services. Manage your orders. Manage your bills and payment methods. Create an account. Forgotten your username or …

Ca.ovh.com

How do I add my OVH email to Outlook? – JanetPanic.com

How do I log into my roundcube email? Login to the Webmail Open the URL given to you by the system administrator in your web browser. The site shows the Login screen, which is used to authenticate a user.

Janetpanic.com

Récupération des logs OVH (script Shell) - Logiciel ...

2018-07-20  · Récupération des logs OVH (script Shell) Un script qui automatise la récupération des logs sur un site hébergé mutualisé linux chez OVH en offre perso. Il automatise la connexion à l'URL des logs d'OVH : logs.ovh.net. En premier : le script env.sh positionne l'environnement OVH avec quelques variables Shell. Toutes ses variables ne ...

Jonathandupre.fr

Vcu email log in - audytseo.ovh

Virginia Commonwealth University. Ranked a top 100 research university, VCU is a place where discovery and creativity go hand in hand; Located in downtown Richmond, Virginia, its more than 200 programs emphasize hands-on learning, creativity and engaging in the world around us.

Audytseo.ovh

Webmail : Solution de messagerie professionnelle - OVHcloud

Webmail : Solution de messagerie professionnelle - OVHcloud - OVH. Webmail Login. Ihre E-Mail-Adresse Bitte bestätigen Sie Ihre E-Mai-Adresse. Passwort. E-Mail-Adresse merken. Login.

Ovh.de

OVH Apache Access log periodic download · GitHub

2015-05-03  · OVH Apache Access log periodic download. GitHub Gist: instantly share code, notes, and snippets.

Gist.github.com

Webmail : Solution de messagerie professionnelle - OVHcloud

Accessibilità delle email. I servizi di posta elettronica offerti da OVHcloud sono disponibili al 99,99%: i messaggi possono essere consultati ovunque e da qualsiasi dispositivo (computer, smartphone...), dal browser o client di posta. Reversibilità dei servizi. Con OVH Mail Migrator (OMM) è possibile migrare gratuitamente e con la massima semplicità e sicurezza gli account …

Ovh.it

email - use php mail function on ovh shared hosting ...

2013-10-09  · Warning: mail (): Failed to connect to mailserver at "localhost" port 25, verify your "SMTP" and "smtp_port" setting in php.ini or use ini_set () That means the mail is trying to be sent thanks to the localhost. But ovh provide a specific domain for mailing : smtp.mydomain.com. So you will have to use ini_set () since you can't change the php ...

Stackoverflow.com

Webmail : Solution de messagerie professionnelle ...

Email Pro. La solución de correo profesional con todas las funcionalidades necesarias para empezar su negocio al precio más ajustado.

Ovh.es

Webmail : Solution de messagerie professionnelle - OVHcloud

Hosted Exchange 2016. La solution de messagerie professionnelle la plus complète avec vos données hébergées en France. Idéal pour : Les Start-up, les TPE ou les PME. Découvrir. Private Exchange 2019. Toutes les fonctionnalités de la référence des solutions de messagerie professionnelles, hébergées sur votre propre serveur virtuel privé.

Ovh.com

GitHub - Ebenolt/ovh_log_exporter: Automatically export ...

Automatically export ovh logs to csv and mail it. Contribute to Ebenolt/ovh_log_exporter development by creating an account on GitHub.

Github.com

Statistiques et Logs OVH [Archives] - Forum OVH

2007-07-12  · c'est pourquoi j'ai rapidement codé un script bash qui à partir d'un ensemble de fichiers .log fournis par OVH me ressort une page html (un tableau), avec les visiteurs et leurs mots-clés. Mon problème actuel est de récupérer les logs de façon "automatique", ou du moins plus rapide que de faire enregistrer sous pour chaque fichier de chaque journée. Est-il …

Forum.ovh.com

OSL

Logs.cluster006.hosting.ovh.net is based in United Kingdom, according to alexa, logs.cluster006.hosting.ovh.net has a global rank of #8276461

Logs-cluster006-hosting-ovh-net.votted.net

logs.ovh.net

Logs.ovh.net - Διεύθυνση IP αναζήτησης και τοποθεσία - [email protected] logs.ovh.net - Cari Alamat IP dan Lokasi - [email protected] logs.ovh.net - Cerca indirizzo IP e posizione - [email protected] logs.ovh.net - 查找IP地址和位置 - [email protected] logs.ovh.net - IPアドレスと場所 …

Ko.ipee.at


Domains Expiration Date Updated

Site Provider Expiration Date
zztt15.com godaddy.com -3 Years, -41 Days
slowguys.io godaddy.com -2 Years, -159 Days
puppieslisting.com atakdomain.com -3 Years, -174 Days
mysoresareeudyog.com publicdomainregistry.com -3 Years, -281 Days
mimastech.com tucows.com -3 Years, -212 Days
cloudcity.io gandi.net 5 Years, 125 Days
inspiration-at.com ionos.com -3 Years, -73 Days
paullott.com godaddy.com -3 Years, -293 Days
yookits.com namecheap.com -3 Years, -73 Days
hyip.com namecheap.com -2 Years, -351 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.6K domains   

    .net746.2K domains   

    .gov23.9K domains   

    .us47.6K domains   

    .ca64K domains   

    .de612.8K domains   

    .uk489.6K domains   

    .it56.8K domains   

    .au68.1K domains   

    .co55.8K domains   

    .biz19.3K domains   

    .info48.3K domains   

    .fr57.9K domains   

    .eu40.2K domains   

    .ru265.5K domains   

    .ph8.3K domains   

    .in84.7K domains   

    .vn25.5K domains   

    .cn84.9K domains   

    .ro28.2K domains   

    .ch23.1K domains   

    .at18.1K domains   

    Browser All