Portalfixe.com


Keyword Suggestion

Portal fixed costs
Portal fixed costs table
Portal fixed costs calculator
Portal pixel
Portal pixeon
Portal fix mod
Portal fixly
Portal fixpay
Portal fiero
Portalfie
Portal fixzy.co.uk
Portal fix ponta grossa



Domain Informations

Portalfixe.com lookup results from whois.namecheap.com server:
  • Domain created: 2005-04-08T18:57:43Z
  • Domain updated: 2024-02-17T15:47:54Z
  • Domain expires: 2025-04-08T18:57:43Z 1 Year, 10 Days left
  • Website age: 18 Years, 355 Days
  • Registrar Domain ID: 149963197_DOMAIN_COM-VRSN
  • Registrar Url: http://www.namecheap.com
  • Registrar WHOIS Server: whois.namecheap.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: +1.6613102107
  • Name server:
    • NS1.INSTALO.COM
    • NS2.INSTALO.COM

Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 145.239.244.73
  • Location: Germany
  • Latitude: 51.2993
  • Longitude: 9.491
  • Timezone: Europe/Berlin

Check all domain's dns records


See Web Sites Hosted on 145.239.244.73

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 145.239.244.73)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 145.239.244.73)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with portalfixe.com

Found 0 emails of this domain

Recent Searched Sites

Szinhaztv.com (3 seconds ago) / HU

Fanforum.com (9 seconds ago) / US

Antigravitybatteries.com (29 seconds ago) / US

Googlecookieplacementprivacysettlement.com (8 seconds ago) / US

Mantecorp.com.br (40 seconds ago) / US

Portalfixe.com (0 seconds ago) / DE

Breathearomatherapy.com (47 seconds ago) / US

Portal.cloudiax.com (2 seconds ago) / DE

Es9944.sofcert.com (1 seconds ago) / NL

Taviasad.com (4 seconds ago) / FR

Aacs-inc.com (5 seconds ago) / US

Connect.epsb.ca (2 seconds ago) / CA

Wuseapp9.top (6 seconds ago) / RU

Jcdf99.com (26 seconds ago) / US

Euroitalia.it (30 seconds ago) / IE

Hoyimagenes.net (26 seconds ago) / US

Mesacountyfair.com (42 seconds ago) / US

Thecatholictraveler.com (7 seconds ago) / US

Cvpvm09.ru (28 seconds ago) / RU

Meyerweb.com (2 seconds ago) / US

Websites Listing

We found Websites Listing below when search with portalfixe.com on Search Engine

Gmail

We would like to show you a description here but the site won’t allow us.

Mail.google.com

NetScaler AAA

You can still check your corporate email by using: 1. Any Shared Health managed Smartphone. 2. Your personal smartphone, which is connected to the Shared Health email system via ActiveSync. 3. Your Shared Health managed laptop. Log into extended office to access your email account.

Webmail.manitoba-ehealth.ca

Outlook

Outlook Office mail

Outlook.office.com

Login

Change Password If you encounter any problems or questions, please contact your local systems support team. If you encounter any problems or questions, …

Mail.myfrhi.com

Sign In

Alternate numbers. Webmail Sign in

Sso.secureserver.net

Outlook – free personal email and calendar from Microsoft

Email and calendar, together in one place. Stay on top of your most important messages and events. Send, receive, and manage your email. Schedule and manage appointments, meetings, or events. See details about contacts when you hover over their name.

Outlook.com

Gmail

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

Accounts.google.com

The Bahamas

Please identify yourself: Username: Password:

Email.bahamas.gov.bs

Securemail.officite.com

Stay signed in for one week ...

Securemail.officite.com

Email and Logins - SAIT

Connect to email from an Android device. Download the Microsoft Outlook app from the Google Play Store. Open the Outlook app on your device. Select Get Started. Enter your SAIT student email address in the format [email protected]. Enter your SAIT computer login password. By default, this is your birthday in the format YYMMDD.

Sait.ca

Outlook - Accenture

Please try again later. Refresh the page. Fewer Details

Email.accenture.com

Pegasus Mail and Mercury

2022-05-09  · Welcome to the home of Pegasus Mail, the Internet's longest-serving PC e-mail system, and of the Mercury Mail Transport System, our full-featured Internet Mail Server. Pegasus Mail is a free product, dedicated to serving all who need it, whilst Mercury is a modestly-priced commercial system that allows free use for private and non-profit users.

Pmail.com

Send mail using Postfix server - Medium

2020-07-21  · [smtp.gmail.com]:587 [email protected]:password Convert the sasl_passwd file into a database file, and delete the original file from the server. We can use the postmap command for ...

Medium.com

Fake Email Address Generator with Inbox: EmailFake.org

Dummy Address Created 8590 Temporary Mails Received 8420. EmailFake.org is a fake email address generator with inbox to use as a disposable email address. Receive dummy mail or temporary email to your selected random email address or your own cerated temporary email ID. Sender. Subject.

Emailfake.org

Fake Email Generator - temp mail address

Fake Email Generator - this is an unlimited number of email accounts that you can use for your own needs. You can easily register an account on any site and receive a registration confirmation to fake mail generator. Fake email is a great way to protect your primary mailbox from junk e-mail avoid spam and stay safe. Fake Email service is free ...

Emailfake.com

Private Email - Web-Based Business Hosting Solution

Namecheap Private Email is a collaborative, cloud-based, and open-source software. It provides a fresh, modern design that works across tablets, desktops, and notebooks – letting users communicate whenever and wherever they want. Private Email allows users to create a public space in shared folders, set and control tasks, create and manage ...

Webmail.privateemail.com

How to Organize Email and Manage Your Inbox Like a Pro

2022-06-01  · To flag a message in Outlook.com: Log in to your Outlook inbox. Hover the mouse over the message you want to flag and click the flag icon. Some mail clients let users set up multiple stars and flags, allowing them to differentiate emails based on specified criteria, for example, low, medium, or high urgency.

Clean.email

Login to Mail - app.titan.email

Login to Mail. Email ID. Password

App.titan.email

Login

Don't have an account? REQUEST A FREE DEMO TODAY! Copyright © 2022 LexisNexis Risk Solutions | Privacy Policy | Terms

Portal.emailage.com

portalfixe.pt Domain Health

Free Users are allowed only one (1) Domain Health Check every 24 hours. Upgrade to get unlimited Domain Health checks and a free Domain Health Monitor.

Mxtoolbox.com


Domains Expiration Date Updated

Site Provider Expiration Date
bookbens.com namesilo.com 90 Days
t2csgd.com namecheap.com -1 Years, -296 Days
rogaine.ca hexonet.net -1 Years, -120 Days
banzaaratravels.com bigrock.com -1 Years, -153 Days
clinicsarmayeh.com joker.com 1 Year, 364 Days
longislandblackcar.com namecheap.com -2 Years, -19 Days
idealpropertiesrealty.com ionos.com -1 Years, -228 Days
edvey.com godaddy.com -1 Years, -214 Days
foxlyme.com godaddy.com -1 Years, -175 Days
a9play2u.com godaddy.com -1 Years, -356 Days

    Browser All

    .com4.3M domains   

    .org1M domains   

    .edu41K domains   

    .net605.3K domains   

    .gov15.9K domains   

    .us31.3K domains   

    .ca44.8K domains   

    .de555.9K domains   

    .uk465.8K domains   

    .it34.3K domains   

    .au46.3K domains   

    .co33.8K domains   

    .biz13.9K domains   

    .info36.6K domains   

    .fr37.1K domains   

    .eu24.5K domains   

    .ru192.8K domains   

    .ph5.6K domains   

    .in54.1K domains   

    .vn18.7K domains   

    .cn39.7K domains   

    .ro19.2K domains   

    .ch11.5K domains   

    .at10.1K domains   

    Browser All