Ratioclothing.com


Keyword Suggestion

Ratio clothing
Ratio clothing denver



Domain Informations

Ratioclothing.com lookup results from whois.godaddy.com server:
  • Domain created: 2009-03-17T01:45:33Z
  • Domain updated: 2025-02-18T19:11:51Z
  • Domain expires: 2026-03-17T01:45:33Z 0 Years, 58 Days left
  • Website age: 16 Years, 306 Days
  • Registrar Domain ID: 1547498501_DOMAIN_COM-VRSN
  • Registrar Url: http://www.godaddy.com
  • Registrar WHOIS Server: whois.godaddy.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: 480-624-2505
  • Name server:
    • NS-10.AWSDNS-01.COM
    • NS-1227.AWSDNS-25.ORG
    • NS-1952.AWSDNS-52.CO.UK
    • NS-814.AWSDNS-37.NET

Network
  • inetnum : 16.175.0.0 - 16.182.255.255
  • name : AMAZO-4
  • handle : NET-16-175-0-0-1
  • status : Direct Allocation
  • created : 2005-09-29
  • changed : 2022-09-30
  • desc : For details of this service please see,http://ec2.amazonaws.com
Owner
  • organization : Amazon.com, Inc.
  • handle : AMAZO-4
  • address : Array,Seattle,WA,98108-1226,US
Technical support
  • handle : ANO24-ARIN
  • name : Amazon EC2 Network Operations
  • phone : +1-206-555-0000
  • email : [email protected]
Abuse
  • handle : AEA8-ARIN
  • name : Amazon EC2 Abuse
  • phone : +1-206-555-0000
  • email : [email protected]
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 16.182.100.245
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 16.182.100.245

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 16.182.100.245)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 16.182.100.245)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with ratioclothing.com

Found 1 emails of this domain
1. [email protected]

Recent Searched Sites

Www3.interceramic.com (3 seconds ago) / US

Gofuelsales.com (2 seconds ago) / US

Rolmas.si (0 seconds ago) / US

Mdaudit.ru (1 seconds ago) / RU

Assamrecruitments.com (1 seconds ago) / GB

Quantaepc.simprosuite.com (1 seconds ago) / US

Dollcraftermarketplace.mysharetribe.com (2 seconds ago) / IE

Dialogos.greek-language.gr (1 seconds ago) / GR

Ggio.gr (2 seconds ago) / IT

Elitserienvolleyboll.se (3 seconds ago) / SE

Bestellung.gas.de (4 seconds ago) / DE

Ratioclothing.com (1 seconds ago) / US

Cuevana-4bzy.s3.amazonaws.com (1 seconds ago) / US

Hightekdesigns.com (4 seconds ago) / US

Transwest.com (2 seconds ago) / US

Merrickcs.org (1 seconds ago) / US

Xn--o80b14lvvim8dcuen4i.com (0 seconds ago) / US

Americadelnorte.edu.mx (5 seconds ago) / US

Femininethemesdemo.com (8 seconds ago) / US

Passagepreparation.com (3 seconds ago) / US

Websites Listing

We found Websites Listing below when search with ratioclothing.com on Search Engine

Contact Ratio Clothing

Contact Email [email protected] Phone (855) 999-2939 12-8 EST, Monday-Friday We're a small company, so we don't have folks answering the phones 24/7, but if you leave us a message we'll get back to you ASAP. To reach a showroom location, see contact information below. Headquarters Ratio Clothing, LLC 2559 16th St Office

Ratioclothing.com

Login - Ratio Clothing

Designer-quality custom dress shirts at off-the-rack prices. Perfect fit guaranteed. Free Shipping. Premium imported fabrics from Italy, Japan, and more.

Ratioclothing.com

Email Gift Card - Ratio Clothing

Email Gift Card. Digital gift card sent via email. A custom dress shirt from Ratio Clothing is the perfect gift. Gift cards can be purchased in any amount. …

Ratioclothing.com

Accessibility - Ratio Clothing

Additionally, while we do not control such vendors, we strongly encourage vendors of third-party digital content to provide content that is accessible and user friendly. Email …

Ratioclothing.com

Shipping and Delivery | Ratio Clothing Custom Made …

$11.95 Flat Rate Shipping Free Shipping for Orders Over $200 Order today for delivery by June 20 - June 27 *Items from our Made in the USA collection will ship July 29 - August 12 *Custom …

Ratioclothing.com

Ratio Clothing - Home - Facebook

The New Standard in Custom Clothing. Classic and Casual Fabrics. Custom Shirts Starting at $79.... 2559 16th St, Denver, CO 80211

Facebook.com

GitHub - RatioClothing/html-email-template: When all …

When all you need is a really simple HTML email template. - GitHub - RatioClothing/html-email-template: When all you need is a really simple HTML email template.

Github.com

html-email-template/email.html at master · RatioClothing/html …

When all you need is a really simple HTML email template. - html-email-template/email.html at master · RatioClothing/html-email-template

Github.com

Ratio Clothing - Crunchbase Company Profile & Funding

Contact Email [email protected] Phone Number 15134611339 Ratio Clothing is a clothing brand that creates designer-quality, American-made custom dress shirts for its …

Crunchbase.com

Ratio Clothing | Custom Dress Shirts

Our Performance Dress Shirts feature a cotton-free combination of nylon and two-way stretch for a shirt that moves with you, wicks away moisture, resists wrinkles, and stays comfortable all …

Ratioclothing.com

Ratio Clothing | LinkedIn

Ratio Clothing | 109 followers on LinkedIn. Ratio Clothing uses imported fabrics, individualized fit, and customer-empowered design to create some of the best dress and casual shirts around. …

Linkedin.com

ratioclothing

2019-08-06  · 21 Likes, 1 Comments - Ratio Clothing (@ratioclothing) on Instagram: “Take your casual Fridays seriously with our Miramar Reds Gingham shirt. Follow the link in our…”

Instagram.com

Ratio Clothing | Denver, CO, US Startup

Website ratioclothing.com; Company Summary Ratio Clothing is a full-stack custom apparel company. That means we: – Make great-fitting custom clothes – Sell direct to customers in our …

Gust.com

File Finder · RatioClothing/html-email-template - GitHub

In this repository All GitHub All GitHub

Github.com

Contact - iCLOTHING

Perform their sales contract with us. To provide customer service and support. We perform customer support through a number of different channels: email; contact forms on …

Iclothing.com

Eric Powell - Email, Phone - CEO/Founder, Ratio Clothing

Find Eric Powell's accurate email address and contact/phone number in Adapt.io. Currently working as CEO/Founder at Ratio Clothing in Colorado, United States. Connect with …

Adapt.io

html-email-template/readme.md at master · RatioClothing/html …

When all you need is a really simple HTML email template. - html-email-template/readme.md at master · RatioClothing/html-email-template

Github.com

Security Overview · RatioClothing/html-email-template · GitHub

GitHub is where people build software. More than 73 million people use GitHub to discover, fork, and contribute to over 200 million projects.

Github.com

Visit Ratioclothing.com - Ratio Clothing.

Ratioclothing.com: visit the most interesting Ratio Clothing pages, well-liked by male users from USA, or check the rest of ratioclothing.com data below. Ratioclothing.com is a relatively …

Links.giveawayoftheday.com

RatioClothing | Styleforum

2011-08-17  · Welcome to our newest affiliate vendor, Threads of Apollo We are very happy to welcome our newest affiliate vendor, Threads of Apollo, a sustainable leather goods company …

Styleforum.net


Domains Expiration Date Updated

Site Provider Expiration Date
mytorchit.com godaddy.com -3 Years, -12 Days
arkansasafp.org whois.godaddy.com -2 Years, -104 Days
ifunxbetnow.com hostinger.com -2 Years, -58 Days
lustrol.com publicdomainregistry.com -3 Years, -233 Days
techoedu.com godaddy.com -3 Years, -64 Days
smartcaresoftware.com enomdomains.com -1 Years, -33 Days
daumdtv.com registrar.amazon.com -2 Years, -267 Days
romsmode.com namecheap.com -3 Years, -199 Days
dns-pay.com pananames.com -3 Years, -154 Days
ekname.com domains.google.com -3 Years, -43 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.6K domains   

    .net746.2K domains   

    .gov23.9K domains   

    .us47.6K domains   

    .ca64K domains   

    .de612.8K domains   

    .uk489.6K domains   

    .it56.8K domains   

    .au68.1K domains   

    .co55.8K domains   

    .biz19.3K domains   

    .info48.3K domains   

    .fr57.9K domains   

    .eu40.2K domains   

    .ru265.5K domains   

    .ph8.3K domains   

    .in84.7K domains   

    .vn25.5K domains   

    .cn84.9K domains   

    .ro28.2K domains   

    .ch23.1K domains   

    .at18.1K domains   

    Browser All