Razkazhimi.online


Keyword Suggestion

Razkazhi mi



Domain Informations

Network
  • inetnum : 20.192.0.0 - 20.255.255.255
  • name : MSFT
  • handle : NET-20-192-0-0-1
  • status : Direct Allocation
  • created : 1998-07-10
  • changed : 2025-06-10
  • desc : To report suspected security issues specific to traffic emanating from Microsoft online services, including the distribution of malicious content or other illicit or illegal material through a Microsoft online service, please submit reports to:,* https://cert.microsoft.com.,For SPAM and other abuse issues, such as Microsoft Accounts, please contact:,* [email protected].,To report security vulnerabilities in Microsoft products and services, please contact:,* [email protected].,For legal and law enforcement-related requests, please contact:,* [email protected],For routing, peering or DNS issues, please,contact:,* [email protected]
Owner
  • organization : Microsoft Corporation
  • handle : MSFT
  • address : Array,Redmond,WA,98052,US
Technical support
  • handle : SINGH683-ARIN
  • name : Singh, Prachi
  • phone : +1-425-707-5601
  • email : [email protected]
Abuse
  • handle : MAC74-ARIN
  • name : Microsoft Abuse Contact
  • phone : +1-425-882-8080
  • email : [email protected]
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 20.245.236.33
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 20.245.236.33

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 20.245.236.33)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 20.245.236.33)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with razkazhimi.online

Found 0 emails of this domain

Recent Searched Sites

Notiondj.world (0 seconds ago) / DE

Purejsq.net (1 seconds ago) / US

Inada-gumi.com (2 seconds ago) / JP

Getaiai.com (2 seconds ago) / HK

Omotesando-beautyshop.com (6 seconds ago) / US

Ocatalogador.com (3 seconds ago) / US

Dollcraftermarketplace.mysharetribe.com (0 seconds ago) / IE

Cite-vouziers.monbureaunumerique.fr (0 seconds ago) / FR

Topbrasstactical.com (1 seconds ago) / US

Jn318.com (2 seconds ago) / US

Razkazhimi.online (0 seconds ago) / US

Apostille.gov.ph (1 seconds ago) / US

Reitoria.ufs.br (1 seconds ago) / BR

Wh.vip (0 seconds ago) /

Thrivingpeopleconsulting.com (2 seconds ago) / US

Pksbb.abacuscity.ch (1 seconds ago) / CH

Hondaautoterrace.com (1 seconds ago) / IN

Cipsdetective.com (0 seconds ago) / LT

Codigos-de-descuentos.com (0 seconds ago) / FR

App.gigworkersolutions.com (2 seconds ago) / US

Websites Listing

We found Websites Listing below when search with razkazhimi.online on Search Engine


Domains Expiration Date Updated

Site Provider Expiration Date
sigasec.com godaddy.com -3 Years, -63 Days
dlpanda.com godaddy.com -3 Years, -11 Days
sportzwow.com name.com -3 Years, -89 Days
habcoon.com namecheap.com -3 Years, -66 Days
600i.org registrygate.com -3 Years, -299 Days
oaresciences.org dreamhost.com -3 Years, -95 Days
matrixproleads.com namecheap.com -2 Years, -145 Days
sanitone.com namesilo.com -3 Years, -225 Days
leydenscience.org whois.godaddy.com 3 Years, 52 Days
hmleague.org fastdomain.com -2 Years, -351 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.8K domains   

    .net746.4K domains   

    .gov23.9K domains   

    .us47.7K domains   

    .ca64.4K domains   

    .de613K domains   

    .uk489.8K domains   

    .it56.9K domains   

    .au68.1K domains   

    .co55.8K domains   

    .biz19.3K domains   

    .info48.3K domains   

    .fr58K domains   

    .eu40.2K domains   

    .ru265.5K domains   

    .ph8.3K domains   

    .in84.7K domains   

    .vn25.6K domains   

    .cn84.9K domains   

    .ro28.2K domains   

    .ch23.2K domains   

    .at18.1K domains   

    Browser All