Swackvacations.com


Keyword Suggestion

Swack vacations
Swack vacation rentals



Domain Informations

Swackvacations.com lookup results from whois.godaddy.com server:
  • Domain created: 2016-06-14T20:56:27Z
  • Domain updated: 2024-12-16T08:53:12Z
  • Domain expires: 2026-06-14T20:56:27Z 0 Years, 162 Days left
  • Website age: 9 Years, 202 Days
  • Registrar Domain ID: 2035520358_DOMAIN_COM-VRSN
  • Registrar Url: http://www.godaddy.com
  • Registrar WHOIS Server: whois.godaddy.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: 480-624-2505
  • Name server:
    • NS1045.UI-DNS.BIZ
    • NS1045.UI-DNS.COM
    • NS1045.UI-DNS.DE
    • NS1045.UI-DNS.ORG

Network
  • inetnum : 74.208.0.0 - 74.208.255.255
  • name : 1AN1-NETWORK
  • handle : NET-74-208-0-0-1
  • status : Direct Allocation
  • created : 2006-09-05
  • changed : 2024-09-13
  • desc : For abuse issues, please use only [email protected],For technical or network problems, please use [email protected],https://www.ionos.com,For abuse issues, please use only [email protected]
Owner
  • organization : IONOS Inc.
  • handle : 11INT
  • address : Array,Philadelphia,PA,19103,US
Technical support
Abuse
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 74.208.236.171
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 74.208.236.171

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 74.208.236.171)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 74.208.236.171)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with swackvacations.com

Found 0 emails of this domain

Recent Searched Sites

Smhsons.org (0 seconds ago) / NL

Portal.mansfield.gov.uk (0 seconds ago) / GB

Pll-therapeutics.com (0 seconds ago) / DE

Audiokauppa.fi (0 seconds ago) / CA

Tirtakepri.co.id (1 seconds ago) /

Trhtlaw.com (3 seconds ago) / JP

Tapt.io (1 seconds ago) / CA

Pirmedia.pl (2 seconds ago) / PL

Farmacialavilla.com (0 seconds ago) / ES

Plateer.com (4 seconds ago) / KR

1z163.com (6 seconds ago) / US

Aandasausalito.com (0 seconds ago) / US

34.213.103.40 (6 seconds ago) / US

Teamkukla.com (2 seconds ago) / US

Juliflexestofados.com.br (6 seconds ago) / BR

Werben.kostenlose-urteile.de (3 seconds ago) / DE

Register.cybereddrivered.com (3 seconds ago) / US

Tirestopwayne.com (1 seconds ago) / US

Swackvacations.com (0 seconds ago) / US

Wiflix-lmcb.s3.amazonaws.com (2 seconds ago) / US

Websites Listing

We found Websites Listing below when search with swackvacations.com on Search Engine

Family Owned and Operated Vacation Properties! - Swack …

Swack Vacations is a privately owned and operated beach rental company specializing in The Outer Banks and Myrtle Beach areas. Our mission is to ensure a fun and stress-free vacation for the whole family! We have a variety of …

Swackvacations.com

Contact Us - Swack Vacations

Contact Swack Vacations. Minimum age of primary renter: 25. No one under the age of 25 may occupy the unit without parent. If you have a question or …

Swackvacations.com

About Us - Swack Vacations

Jeff and Dawn Swackhammer. We’re Jeff and Dawn Swackhammer, 30-year owners and operators of Swack Vacations. We are hands-on owners, with our …

Swackvacations.com

Aruba - Swack Vacations

Rather than staying in a hotel room, stay at your own private pool house! Our Aruba vacation home is fully equipped with amenities such as multiple A/C units throughout the home, a resort-style pool, 3 additional bedroom suites located by the pool, and a large kitchen so you can save money on having to eat out every meal! Not to mention you’ll be a couple of thousand feet …

Swackvacations.com

Lake Norman, NC - Swack Vacations

Call or email us for more information. "We had a great time at this fabulous property! Our family reunion was smaller than anticipated but a rousing success nonetheless! Southern Breeze was clean, well-maintained, amenities terrific and the owner wonderful in accommodating some special requests (with prompt response). We thoroughly enjoyed the house, location, and …

Swackvacations.com

Myrtle Beach, SC - Swack Vacations

As a popular spring-break destination, golfing hub, and beloved family vacation spot—Myrtle Beach is the “happy place” for a range of travelers. Take in a foot-stomping show at the Carolina Opry, soak up the sunbeams on the Grand Strand’s many beaches, or hit up some theme-park rides or wildlife tours. Spend your evening strolling around the boardwalk, funnel cake in hand.

Swackvacations.com

MOTORS Automotive Auto Parts & Accessories NEW STARTER …

Find many great new & used options and get the best deals for NEW STARTER FITS SEA-DOO 290-888-993 290-888-999 420-888-9933 420-888-994 at the best online prices at , Free shipping for many products,Wholesale Price,Incredible shopping paradise,Offering chic and …

Swackvacations.com

Shuswap Lake Cabin Rentals - Scotch Creek Cottages

Phone: 250-955-0080 Toll-Free: 1-800-979-3599 Email: [email protected]. Follow Us. Like Us. The Perfect Lake Front Family Event Resort. Scotch Creek Cottages is the perfect setting for your next family event. Our Shuswap Lake vacation rentals include 20 deluxe family cottages, 300 feet of beach and over an acre of grass. Think of our Shuswap Lake cabin rentals for your family …

Shuswap.ca

Special Vacations

Email * Message * Thank you for your message! We’ll be in touch as soon as possible. Introduction. What We Do. New Page. 215 844 1295 [email protected] WE MOVED! 7020 Chew Avenue Philadelphia, PA 19119. Special Vacations. 6757 Greene St. Ste 200B, Philadelphia, PA 19119, ...

Specialvacations.net

My Vacation Escape Services

My Vacation Escape Services offers vacation villas for rent, and a variety of other services including transportation, excursions and concierge service, with emphasis on personalized customer service. Our priority is your vacation success.

Myvacationescapeservices.com

Travel Agents - VAX VacationAccess | SouthwestVacations

You will receive an e-mail confirmation once approved. At that time, you will also need to register your agency to use the electronic booking engine at www.vaxvacationaccess.com. Why join? Exclusive access to Southwest Airlines bulk fares; Commission on all air fare classes of service; Exclusive travel agent-only promotions and incentives ; Competitive commission on features …

Southwestvacations.com

U.S Mail shirt Cute Mail Carrier T-Shirt United States Postal

Mail shirt Cute Mail Carrier T-Shirt United States Postal Worker Shirt Gift at the best online prices at , Free shipping for many products,Find many great new & used options and get the best deals for U,S,The Style of Your Life,Thousands of Products,we ship worldwide,Good product low price,reliable delivery services, check us out!

Swackvacations.com

About Us - SWAP Working Holidays

Please send an email to [email protected] with the following details: Your name; Your nationality; The program (or programs) you are interested in; Your phone number (including area code) The dates/times you are available. Please note we can only arrange call backs within business hours (Monday - Friday, 9:00am to 5:00pm EST) We need these details to ensure we can arrange a …

Swap.ca

Swack Vacations - Home - Facebook

Swack Vacations. 662 likes · 1 talking about this. Swack Vacations owns and operates vacation rental properties in Outer Banks, Myrtle Beach, Florida …

Facebook.com

My Account - Southwest Vacations

Customer care. Book online or call 1-800-243-8372 any day of the week, from 9AM to 12AM EST. Help with your current reservation is available Mon-Sun from 9AM to 9PM EST. E-mail us a question; Retrieve a reservation

Res.southwestvacations.com

Log In | Workplace Financial Services

Stock Plan Services including StockPlanManager® and EquiView® Platforms. Log in here to manage reporting and recordkeeping tasks for your company's stock plan. Log In to the SPS Platforms. Talk with us about all the options available to your business.

Workplacefinancialservices.schwab.com

SWVACARS - YouTube

Tutorial on how to use SWVACARS http://virtualswa.com/

Youtube.com

SWAP Working Holidays

SWAP Working Holidays is dedicated to helping you successfully live and work abroad. We've been doing this since 1975 and are proudly Canadian.

Swapworkingholidays.ca

Work at the Beach. Private lazy river, regular&kiddie pool.

Our rental business www.swackvacations.com is growing each year. We have worked hard to get to be and stay a premier partner with VRBO. We try our best to make sure that your vacation is a pleasurable one, because our main thing that makes us happy is to see you return. Our Property Manager Renata Beebe (724-991-7326) is our amazing contact person that can help …

Vrbo.com

Customer Service - Travel Information | SouthwestVacations

E-travel documents will be sent electronically to the e-mail address provided for the first traveler on the record within 48-hours of completing your vacation package purchase. Your e-travel documents will include your airline and hotel confirmation numbers and your itinerary. If you purchased add-on options that require a voucher, those will also be included on your e-travel …

Southwestvacations.com


Domains Expiration Date Updated

Site Provider Expiration Date
familyfaithbuilders.org fastdomain.com -2 Years, -245 Days
onix.so -3 Years, -189 Days
ealasercenter.com godaddy.com -2 Years, -60 Days
khadims.com ionos.com -3 Years, -105 Days
nsokote.com danesconames.com -3 Years, -253 Days
guidemarkinc.com godaddy.com 1 Year, 269 Days
iibmindia.in godaddy.com -3 Years, -199 Days
m1914.org whois.godaddy.com -3 Years, -246 Days
doctorbarbiturate.com ilovecom -3 Years, -220 Days
givr.pro godaddy.com -3 Years, -117 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.2K domains   

    .net746.9K domains   

    .gov23.6K domains   

    .us47.6K domains   

    .ca62.9K domains   

    .de612.2K domains   

    .uk489.4K domains   

    .it56.6K domains   

    .au67.9K domains   

    .co55.9K domains   

    .biz19.4K domains   

    .info48.4K domains   

    .fr57.6K domains   

    .eu40.1K domains   

    .ru265.9K domains   

    .ph8.3K domains   

    .in84.8K domains   

    .vn25.6K domains   

    .cn85.2K domains   

    .ro28.2K domains   

    .ch23K domains   

    .at18K domains   

    Browser All