Tailor-kashiwabara.on.omisenomikata.jp


Keyword Suggestion

Taylor kashiwabara
Taylor kashiwabara npi



Domain Informations

Administrator
  • role : Japan Network Information Center
  • address : Uchikanda OS Bldg 4F, 2-12-6 Uchi-Kanda,Chiyoda-ku, Tokyo 101-0047, Japan
  • country : JP
  • phone : +81-3-5297-2311
  • fax : +81-3-5297-2312
  • email : [email protected]
  • admin-c : JI13-AP
  • tech-c : JE53-AP
  • handle : JNIC1-AP
  • mnt-by : MAINT-JPNIC
  • last-modified : 2022-01-05T03:04:02Z
  • source : APNIC
Technical support
  • role : Japan Network Information Center
  • address : Uchikanda OS Bldg 4F, 2-12-6 Uchi-Kanda,Chiyoda-ku, Tokyo 101-0047, Japan
  • country : JP
  • phone : +81-3-5297-2311
  • fax : +81-3-5297-2312
  • email : [email protected]
  • admin-c : JI13-AP
  • tech-c : JE53-AP
  • handle : JNIC1-AP
  • mnt-by : MAINT-JPNIC
  • last-modified : 2022-01-05T03:04:02Z
  • source : APNIC
Network
  • inetnum : 210.144.0.0 - 210.159.255.255
  • name : JPNIC-NET-JP
  • country : JP
  • remarks : JPNIC Allocation Block,Authoritative information regarding assignments and,allocations made from within this block can also be,queried at whois.nic.ad.jp. To obtain an English,output query whois -h whois.nic.ad.jp x.x.x.x/e
  • mnt-by : MAINT-JPNIC
  • mnt-irt : IRT-JPNIC-JP
  • status : ALLOCATED PORTABLE
  • last-modified : 2015-12-01T22:31:47Z
  • source : APNIC
Owner
  • organization : Japan Network Information Center
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 210.150.254.122
  • Location: Japan
  • Latitude: 35.69
  • Longitude: 139.69
  • Timezone: Asia/Tokyo

Check all domain's dns records


See Web Sites Hosted on 210.150.254.122

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 210.150.254.122)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 210.150.254.122)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with tailor-kashiwabara.on.omisenomikata.jp

Found 0 emails of this domain

Recent Searched Sites

Technicallyfunny.com (2 seconds ago) /

Loireauxence.loire-atlantique.e-lyco.fr (4 seconds ago) / BE

Easytechnology.net (3 seconds ago) / US

Santuariodeestibaliz.peregrinosdelaeucaristia.org (2 seconds ago) / US

Sdfzdx.com (6 seconds ago) / CN

Cinego-2r2i.s3.amazonaws.com (0 seconds ago) / US

Tailor-kashiwabara.on.omisenomikata.jp (0 seconds ago) / JP

Cyn-pro.com (4 seconds ago) / US

Pollockphotography.gotphoto.com (1 seconds ago) / US

Policecreditgy.com (2 seconds ago) / US

Surecollect.com (1 seconds ago) / US

Twitter-trending.com (1 seconds ago) / US

Dmc-v3.embeddigital.com (2 seconds ago) / US

Archives.meuse.fr (1 seconds ago) / FR

Arcofm.com (0 seconds ago) / ES

Contenido.uned.es (6 seconds ago) / ES

Arthurvwur90234.arwebo.com (3 seconds ago) / US

Ar.scoopempire.com (9 seconds ago) / IN

Dollcraftermarketplace.mysharetribe.com (0 seconds ago) / IE

Arti.edu.az (1 seconds ago) / AZ

Websites Listing

We found Websites Listing below when search with tailor-kashiwabara.on.omisenomikata.jp on Search Engine


Domains Expiration Date Updated

Site Provider Expiration Date
teslaphilippines.com enomdomains.com -3 Years, -56 Days
daikinoman.com cscdbs.com -3 Years, -292 Days
redmoxy.com godaddy.com -3 Years, -17 Days
doubledbot.xyz internetx.com -3 Years, -301 Days
shipyarddoor.com gkg.net 3 Years, 115 Days
pacifichearinginc.com godaddy.com 4 Years, 22 Days
hanoverhall.com godaddy.com -3 Years, -81 Days
k4fins.com enomdomains.com -3 Years, -329 Days
themobilehunt.com godaddy.com -3 Years, -185 Days
neobabel.org dreamhost.com -3 Years, -51 Days

    Browser All

    .com6.6M domains   

    .org1.1M domains   

    .edu62.6K domains   

    .net747.7K domains   

    .gov24.3K domains   

    .us48K domains   

    .ca66.2K domains   

    .de613.7K domains   

    .uk490.4K domains   

    .it57.3K domains   

    .au68.7K domains   

    .co56.2K domains   

    .biz19.3K domains   

    .info48.4K domains   

    .fr58.6K domains   

    .eu40.4K domains   

    .ru265.6K domains   

    .ph8.4K domains   

    .in85K domains   

    .vn25.6K domains   

    .cn85.1K domains   

    .ro28.3K domains   

    .ch23.3K domains   

    .at18.2K domains   

    Browser All