Unitedcrowd.com


Keyword Suggestion

Unitedcrowd
United crown of america
United crown
United crowns eu4
United crown pump and drilling
United crown hayden idaho
United crown cargo ship
United crown pump & drilling hayden id



Domain Informations

Unitedcrowd.com lookup results from whois.registrar.internetx.com server:
  • Domain created: 2013-02-14T19:20:53Z
  • Domain updated: 2025-02-15T08:36:03Z
  • Domain expires: 2026-02-14T19:20:53Z 0 Years, 29 Days left
  • Website age: 12 Years, 335 Days
  • Registrar Domain ID: 1780377908_DOMAIN_COM-VRSN
  • Registrar Url: http://www.internetx.com
  • Registrar WHOIS Server: whois.registrar.internetx.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: +49.94159559480
  • Name server:
    • CHIN.NS.CLOUDFLARE.COM
    • YICHUN.NS.CLOUDFLARE.COM

Network
  • inetnum : 104.16.0.0 - 104.31.255.255
  • name : CLOUDFLARENET
  • handle : NET-104-16-0-0-1
  • status : Direct Allocation
  • created : 2010-07-09
  • changed : 2024-11-25
  • desc : All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse,Geofeed: https://api.cloudflare.com/local-ip-ranges.csv
Owner
  • organization : Cloudflare, Inc.
  • handle : CLOUD14
  • address : Array,San Francisco,CA,94107,US
Abuse
Technical support
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 104.26.10.99
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 104.26.10.99

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 104.26.10.99)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 104.26.10.99)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with unitedcrowd.com

Found 1 emails of this domain
1. [email protected]

Recent Searched Sites

Mtrc.co.kr (3 seconds ago) / KR

Mepet.co.kr (0 seconds ago) / KR

Investbm.com (2 seconds ago) / US

Big-xyt.com (3 seconds ago) / US

Wecanmake.org (0 seconds ago) / GB

Ants.jp (2 seconds ago) / JP

Indopicri.co.id (3 seconds ago) / SG

Glogroup.com (0 seconds ago) / US

Unitedcrowd.com (0 seconds ago) / US

Funeplus.souscription-obseques.com (3 seconds ago) / FR

Pineschile.cl (3 seconds ago) / NO

Thomasrecom.com (1 seconds ago) / US

Centennialcollegesimklar.com (1 seconds ago) / CA

Mengte8866.cc (0 seconds ago) / AU

Dollcraftermarketplace.mysharetribe.com (1 seconds ago) / IE

Chemiumcorp.com (5 seconds ago) / US

Thepetalconnection.org (0 seconds ago) / US

Agrilinkhub.com (5 seconds ago) / ID

Kumc.edu (0 seconds ago) / US

Myuniguide.com (0 seconds ago) / LT

Websites Listing

We found Websites Listing below when search with unitedcrowd.com on Search Engine

Sign-in - UnitedCrowd

© 2022 UnitedCrowd. All Right Reserved.

App.unitedcrowd.com

Impressum - UnitedCrowd

UnitedCrowd GmbH Venloerstr. 5 – 7 50672 Köln / Deutschland. E-Mail: [email protected] Geschäftsführer: Michael Goeymen & André Wendt. Handelsregister: HRB 98686. D-U-N-S No. 342902834 . Token Provider: UnitedCrowdCom Ltd. Central Tower / 28 Queens Road 999077 Hongkong. E-Mail: [email protected] Managing Director: Michael Goeymen. Registereintrag: …

Unitedcrowd.com

About us - UnitedCrowd

UnitedCrowd is a global platform for digital direct finance. We use blockchain technology to connect companies with investors to finance them. We are registered as German GmbH with headquarters in Cologne. As a German company with many years of experience we have an excellent network in Germany and Europe, where the focus of our tokenization service lies. …

Unitedcrowd.com

UnitedCrowd Social Rewards - UnitedCrowd

2021-12-02  · The tasks were chosen in such a way that they bring benefit to UnitedCrowd and serve to build up the community, such as promoting greater visibility in social media. We use our social rewards system for ourselves as well as for our clients. Participation is free for users and will be linked to possession of at least 1,000 UCT in the future. The program is integrated in …

Unitedcrowd.com

Help Center - UnitedCrowd

In our Help Center, interested parties now have 24/7 answers to many questions.

Unitedcrowd.com

Privacy Policy - UnitedCrowd

Email: [email protected] Website: www.unitedcrowd.com. 3. Cookies The Internet pages of the UnitedCrowdCom Ltd. use cookies. Cookies are text files that are stored in a computer system via an Internet browser. Many Internet sites and servers use cookies. Many cookies contain a so- called cookie ID. A cookie ID is a unique identifier of the cookie. It consists of a character …

Unitedcrowd.com

@UnitedCrowd_com | Twitter

2022-03-15

Twitter.com

Outlook

Outlook Office mail

Outlook.office.com

@unitedcrowd_com | Twitter

2022-03-13

Twitter.com

UnitedCrowd Company Profile | Management and Employees List

Find contact information for UnitedCrowd. Learn about their Business Services, Custom Software & IT Services market share, competitors, and UnitedCrowd's email format.

Datanyze.com

© UnitedCrowd.

Sign in. IEO (Token Sale) UnitedCrowd Token - UCT. For companies. © UnitedCrowd.

Unitedcrowd.zendesk.com

UnitedCrowd ICO (UCT) Details, Rating and Reviews ...

2021-02-16  · UnitedCrowd enables tokenization in compliance with regulations. Our Tokenization Framework is an automated solution for digitizing values, including all rights and obligations contained in them, by issuing a token that is registered in a distributed ledger technology (DLT) infrastructure. The resulting tokens represent the digitized form of these values, which can be …

Bestcoinlist.com

Unitedcrowd Information | Unitedcrowd Profile

Unitedcrowd is a company based in Hong Kong, Central And Western District, HK founded in 2016.

Rocketreach.co


Domains Expiration Date Updated

Site Provider Expiration Date
wagnerplanroom.com godaddy.com -3 Years, -46 Days
lbmfg.com namecheap.com 2 Years, 45 Days
outletstussy.com name.com -3 Years, -238 Days
loweaudiology.com godaddy.com -2 Years, -126 Days
hometownapparel.com godaddy.com -3 Years, -150 Days
fuwenb.cc namesilo.com -3 Years, -66 Days
soruindir.net turhost.com -3 Years, -263 Days
na3em.cc namecheap.com -3 Years, -183 Days
funchatt.com 1api.net -2 Years, -364 Days
sehogar.com launchpad.com -3 Years, -40 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu61.3K domains   

    .net745.9K domains   

    .gov23.7K domains   

    .us47.5K domains   

    .ca63.3K domains   

    .de612.4K domains   

    .uk489.4K domains   

    .it56.7K domains   

    .au67.9K domains   

    .co55.7K domains   

    .biz19.3K domains   

    .info48.2K domains   

    .fr57.6K domains   

    .eu40.1K domains   

    .ru265.6K domains   

    .ph8.3K domains   

    .in84.6K domains   

    .vn25.5K domains   

    .cn84.8K domains   

    .ro28.2K domains   

    .ch23K domains   

    .at18K domains   

    Browser All