Diversedining.epayslips.co.uk


Keyword Suggestion

Diverse dining
Diverse dining market
Diverse dining uk
Diverse dining milwaukee
Diverse dining limited
Diverse dining ltd london
Diverse dining ltd companies house
Diverse dining brands
Diverse dining ltd shake shack
Diverse dining market milwaukee
Diverse dining market menu
Diverse dining head office



Domain Informations

Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 185.150.144.31
  • Location: Grimsby United Kingdom
  • Latitude: 53.5364
  • Longitude: -0.0967
  • Timezone: Europe/London

Check all domain's dns records


See Web Sites Hosted on 185.150.144.31

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 185.150.144.31)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 185.150.144.31)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with diversedining.epayslips.co.uk

Found 0 emails of this domain

Recent Searched Sites

Careers.focusbankers.com (7 seconds ago) / US

Docs.absence.io (0 seconds ago) / US

Redasset.com.br (0 seconds ago) / US

Alicebluefinancialservicesprivatelimited.viewpage.co (1 seconds ago) / US

Denisparent.tryrubi.ai (1 seconds ago) / US

Apkhops.com (5 seconds ago) / US

E-must.com (6 seconds ago) / US

Codeplas.pt (0 seconds ago) / FR

Diversedining.epayslips.co.uk (0 seconds ago) / GB

News.seriousskincare.com (9 seconds ago) / US

Shop.tefittazza.com (0 seconds ago) / US

Krasnoyarsk.defiletto.ru (9 seconds ago) / RU

Bezdepic.ru (1 seconds ago) / RU

Ampika.ru (2 seconds ago) / RU

5.39.37.50 (1 seconds ago) / FR

Harkov.nuipogoda.ru (1 seconds ago) / RU

Unibrands.co (0 seconds ago) / CA

Zigcou.com (0 seconds ago) / US

Alvinisd.net (1 seconds ago) / US

Seamar.com.tr (1 seconds ago) / US

Websites Listing

We found Websites Listing below when search with diversedining.epayslips.co.uk on Search Engine

diversedining.epayslips.co.uk

We would like to show you a description here but the site won’t allow us.

Diversedining.epayslips.co.uk

Contact ePayslips | ePayslips

All support queries must be directed via your employer's Payroll/HR Teams. ePayslips are unable to provide support to employees directly. Have trouble accessing your ePayslips account? If you’re unable to login to your account, you’ll need to complete the account recovery process. If …

Epayslips.co.uk

Diversedining.epayslips.co.uk Site - topsitessearch.com

2022-04-02  · Diverse Dining Ltd CEO, CFO, CTO, CMO Email and Phone Number Diverse Dining Ltd employs 29 employees. View. Rafi mohamed. Receiver - View. Omar masri. Restaurant supervisor. United arab emirates. View. Barbara carella. Head of property. United …

Topsitessearch.com

Epayslips

We would like to show you a description here but the site won’t allow us.

Login.epayslips.co.uk

ePayslips

Login to ePayslips. Good morning. Username

Employee.epayslips.co.uk

ePayslips

Login to ePayslips. Good afternoon. Username

Employee.epayslips.co.uk

E-Pay Slip : Login

↺ reload code. Login. Forgotten password? Register for E-PaySlip

Gogpayslip.com

Diverse Consulting Group (Uk) Ltd. email format | Diverse …

Diverse Consulting Group (Uk) Ltd. use these email formats. Get emails and phone number of Diverse Consulting Group (Uk) Ltd. employees.

Data.aeroleads.com

epayslips | Dataplan

2020-07-07  · Our own ePayslips solution was launched in 2012 and our vision was always for it to be ‘more than just an… From pulp to payslip: a 10 year history. Written on 18 Sep 2018 by …

Dataplanpayroll.co.uk

Diverse Dining email format | Diverse Dining.com emails

Diverse Dining use these email formats. Get emails and phone number of Diverse Dining employees. Diverse Dining email format | Diverse Dining.com emails. Email and Phone …

Data.aeroleads.com

DIVERSE DINING LTD overview - Find and update company …

People for DIVERSE DINING LTD (08282915) More for DIVERSE DINING LTD (08282915) Registered office address 64 Princes Court Brompton Road, London, England, SW3 1ET . …

Find-and-update.company-information.service.gov.uk

Diverse Dining Ltd Email Format & Employee Directory | ContactOut

Get details for Diverse Dining Ltd’s 2 employees, email format for and phone numbers. Diverse Dining Ltd launches fantastic restaurant brands in the United Kingdom. Join the Diverse …

Contactout.com

Whois epayslips.com

Whois Lookup for epayslips.com. WHOIS. Domains. Registration. Register a Domain Get your domain name now; Domain ... Enterprise Email Advanced Email for growing businesses & …

Whois.com

diversedining.co.uk - Overview, News & Competitors

View diversedining.co.uk (www.diversedining.co.uk) location in Hertfordshire, United Kingdom , revenue, industry and description. Find related and similar companies as well as employees …

Zoominfo.com

Diverse Dining Ltd Email Formats & Employee Contacts

Contact and general information about Diverse Dining Ltd company, headquarter location in London, England. Email formats & phone numbers of Diverse Dining Ltd 200-500 …

Signalhire.com

Contact Us - UK | Diversey United Kingdom

Please fill out the form below and a representative from our team will be in touch. Diversey is committed to protecting and respecting your privacy, and we’ll only use your personal …

Diversey.co.uk

Diverse Dining Ltd | LinkedIn

Diverse Dining Ltd | 854 followers on LinkedIn. Diverse Dining is a holding company for 2 trading brands (Shake Shack & PF Chang’s) with an annual turnover of £35 million through 20 …

Ca.linkedin.com

Diverse Utility Solutions Limited email format | Diverse Utility ...

Diverse Utility Solutions Limited CEO, CFO, CTO, CMO Email and Phone Number Diverse Utility Solutions Limited employs 7 employees. View. Jo richards. Bristol branch manager. Bristol, …

Aeroleads.com

Diverse Dining – Boston (Reviews and phone number)

2022-03-26  · Diverse Dining. Diverse Dining. Boston, United States ··· Open now Accepts Credit Cards. Contacts Hours Reviews Related places Get directions Photos page . Contacts. …

Unilocal.net

Diverse Dining - As the days get warmer it is important...

Email or Phone: Password: Forgot account? Sign Up. Diverse Dining. March 28 · As the days get warmer it is important that we explore our local neighborhoods. There are lots of great …

Facebook.com


Domains Expiration Date Updated

Site Provider Expiration Date
stofft.com godaddy.com 3 Years, 233 Days
dekaron-rising.com ordertld.com -3 Years, -317 Days
desilux.com godaddy.com 5 Years, 260 Days
costamayacruiseexcursions.com register.com -2 Years, -255 Days
clintonct.org register.com -4 Years, -134 Days
thespiritandtruth.com namecheap.com -3 Years, -262 Days
reycomix.com godaddy.com -4 Years, -42 Days
isun3d.net wanwang.aliyun.com -4 Years, -60 Days
mvpex.io netearthone.com -2 Years, -191 Days
mikehowellplumbing.com wildwestdomains.com 201 Days

    Browser All

    .com6.5M domains   

    .org1.1M domains   

    .edu62.8K domains   

    .net740.1K domains   

    .gov24.5K domains   

    .us47.1K domains   

    .ca68.4K domains   

    .de616K domains   

    .uk490.8K domains   

    .it58.4K domains   

    .au69.1K domains   

    .co54.8K domains   

    .biz18.9K domains   

    .info46.7K domains   

    .fr60K domains   

    .eu40.3K domains   

    .ru260.7K domains   

    .ph8.4K domains   

    .in82.8K domains   

    .vn24.9K domains   

    .cn83.2K domains   

    .ro28.3K domains   

    .ch23.8K domains   

    .at18.6K domains   

    Browser All