Ranikamalapatirailwaystation.com


Keyword Suggestion

Rani kamalapati railway station



Domain Informations

Ranikamalapatirailwaystation.com lookup results from whois.godaddy.com server:
  • Domain created: 2021-11-13T09:47:31Z
  • Domain updated: 2021-11-13T10:12:47Z
  • Domain expires: 2022-11-13T09:47:31Z 0 Years, 136 Days left
  • Website age: 0 Years, 228 Days
  • Registrar Domain ID: 2654645343_DOMAIN_COM-VRSN
  • Registrar Url: http://www.godaddy.com
  • Registrar WHOIS Server: whois.godaddy.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: 480-624-2505
  • Name server:
    • THOMAS.NS.CLOUDFLARE.COM
    • VEDA.NS.CLOUDFLARE.COM

Network
  • inetnum : 104.16.0.0 - 104.31.255.255
  • name : CLOUDFLARENET
  • handle : NET-104-16-0-0-1
  • status : Direct Allocation
  • created : 2010-07-09
  • changed : 2021-07-01
  • desc : All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse
Owner
  • organization : Cloudflare, Inc.
  • handle : CLOUD14
  • address : Array,San Francisco,CA,94107,US
Abuse
Technical support
Domain Provider Number Of Domains
godaddy.com 235910
namecheap.com 83378
networksolutions.com 57494
tucows.com 42654
publicdomainregistry.com 31948
whois.godaddy.com 25918
enomdomains.com 19727
namesilo.com 17145
domains.google.com 16648
cloudflare.com 15611
name.com 15293
gmo.jp 14562
fastdomain.com 11695
register.com 11061
net.cn 10398
cscdbs.com 10390
gandi.net 10101
registrar.amazon.com 10100
ionos.com 9639


Host Informations

  • IP address: 104.21.56.119
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 104.21.56.119

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 104.21.56.119)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 104.21.56.119)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with ranikamalapatirailwaystation.com

Found 0 emails of this domain

Recent Searched Sites

Animefrenzy.org (5 seconds ago) / US

Zimmermannwear.com (27 seconds ago) / US

Paragoneventmarketing.com (12 seconds ago) / GB

Firewaterlight.net (1 mins ago) / US

Southlive.in (3 seconds ago) / SG

Bonavi.ru (1 mins ago) / RU

Ahps.org (49 seconds ago) / US

Fantascienza.com (27 seconds ago) / DE

Starsession.m4n.nl (13 seconds ago) / NL

Peelregion.ca (1 seconds ago) / US

Homeanddoor.com (53 seconds ago) / US

Ibew424.net (54 seconds ago) / US

Vuletic.shop (11 seconds ago) / US

Recipes.net (45 seconds ago) / US

Tektesettur.com (1 mins ago) / NL

Sesv.nmcourts.gov (7 seconds ago) / US

Dittgrafisk.no (31 seconds ago) / NO

Ranikamalapatirailwaystation.com (1 seconds ago) / US

Tmh.psdschools.org (56 seconds ago) / US

Pocztowy24.pl (41 seconds ago) / PL

Websites Listing

We found Websites Listing below when search with ranikamalapatirailwaystation.com on Search Engine

Downloads - Rani Kamalapati Railway Station | Bansal Group

Rani Kamalapati Railway Station formerly known as Habibganj Railway Station. Facebook-f Instagram Linkedin-in Twitter Youtube. Home; About Us; Rani Kamalapati Railway Station (RFP)

Ranikamalapatirailwaystation.com

Bansal News Education Fair 2022 – Bansal Group, Bhopal

2022-06-06  · Call : 077710 09741 Address : Hataikheda, Near Patel Nagar, Raisen Road, Bhopal - 462 022 (M.P.) Email ID : [email protected]

Educationfair.ranikamalapatirailwaystation.com

ranikamalapatirailwaystation-platform : Free Download, Borrow, …

Ranikamalapatirailwaystation-platform Item Preview Air-Concourse-East-Building.jpg . Air-Concourse-West-Building.jpg . Women-AC-Lounge.jpg . ranikamalapatirailwaystation-platform.jpg . ranikamalapatirailwaystation-security-room.jpg . remove-circle Share or Embed This Item . Share to Twitter. Share to Facebook. Share to Reddit ...

Archive.org

ranikamalapatirailwaystation.com Webrate website statistics and …

2021-12-02  · Ranikamalapatirailwaystation.com registered under .COM top-level domain. Check other websites in .COM zone . The last verification results, performed on (November 17, 2021) ranikamalapatirailwaystation.com show that ranikamalapatirailwaystation.com has a valid and up-to-date wildcard SSL certificate issued by Let's Encrypt expiring on February 11, …

Webrate.org

ranikamalapatirailwaystation photos on Flickr | Flickr

Flickr photos, groups, and tags related to the "ranikamalapatirailwaystation" Flickr tag.

Flickr.com

Rani Kamlapati Railway Station - Drishti IAS

2021-11-16  · Rani Kamlapati Railway Station has been redeveloped on PPP model. The total cost of this project is Rs 450 crore. This railway station is the first model station in the country to be built under public-private partnership. Rani Kamalapati was a Gond queen who was married to the Raja of Ginnaurgarh. She is considered the last Hindu queen of the ...

Drishtiias.com

Rani Kamalapati Railway Station - Crunchbase Company Profile

The Ministry of Railways has privatized Rani Kamalapati Railway Station, making it India's first private railway station. Search Crunchbase. Start Free Trial . Chrome Extension. Solutions. Products. Resources. Resources. Pricing. Log In. Organization. Rani Kamalapati Railway Station . Connect to CRM . Save . Summary People Technology Signals & News. About. The Ministry …

Crunchbase.com

Rani Kamlapati Railway Station: India’s State-of-the-art ... - YouTube

The Habibganj railway station in Bhopal was recently renamed. It has been named after Gond queen Rani Kamalapati. The revamped railway station has airport-li...

Youtube.com

Rani Kamlapati Railway Station - ホーム

Rani Kamlapati Railway Station - 「いいね!」21件 · 2人が話題にしています - ranikamalapatirailwaystation

Ja-jp.facebook.com

Rani Kamalapati railway station

Find out the list of trains that arrive at Rani Kamalapati railway station.Get information for all trains passing through Rani Kamalapati - Arrival, Departure, Train Number, Stops, Stoppage time, Platform Number, and Timings. Some of the trains that arrive at Rani Kamalapati railway station are 07094 BKN SC SPECIAL, 07093 BKN SUVIDHA SPECIAL, 11069 TULSI EXPRESS and …

Ixigo.com

RANI KAMALAPATI (RKMP) Railway Station Time Table

No Train No Name Type Run Days Arrival Time Departure Time; 1: 01665 RKMP- AGARTALA EXP Tod - TOD THU: Starting Station: 15:30: 2: 01666 AGTL-RKMP FESTIVAL SPL Tod - TOD

Trainspnrstatus.com

Rani Kamalapati Railway Station Inaugurated

2021-11-16  · Prime Minister, Narendra Modi has inaugurated the Rani Kamalapati Railway Station on Monday. 21B7BF8D-4CAA-470F-914E-7D85FBF51E77 At www.thinkwithniche.com, you get small business ideas, startup and business blogs, trending world business news, and success tips that ensure sustainable growth and development of your business under one roof.

Thinkwithniche.com

ranikamalapatirailwaystation-platform | Rani Kamalapati Rail… | Flickr

Rani Kamalapati Railway Station is one of the cleanest railway stations in the world it also gets a 5 GEM rating.

Flickr.com

Rani Kamalapati railway station

This list also gives you an idea of the stoppage time of the trains at Rani Kamalapati railway station. Use the complete train list for Rani Kamalapati to find availability of berth in different trains. With ixigo, finding the Indian Railways trains and booking a …

Ixigo.com

New hi-tech Organic Tea... - Rani Kamalapati Railway Station

New hi-tech Organic Tea vending services have been started at Rani Kamalapati Railway Station. Tea & coffee is made through using Mineral water and …

Facebook.com

Rani Kamalapati Railway Station - YouTube

Rani Kamalapati Railway Station formerly known as Habibganj. "Rani Kamalapati Railway Station" Leading a way to progress, Redefining eminence in …

Youtube.com

Railway station with Airport-like facilities: PM inaugurates

Prime Minister Narendra Modi on Monday inaugurated the redeveloped Rani Kamalapati Railway Station in Bhopal. The redeveloped Rani Kamalapati Railway station...

Youtube.com

About Rani Kamalapati Railway Station | Flickr

Have something nice to say about Rani Kamalapati Railway Station? Write a testimonial. About; Jobs; Blog; Developers; Guidelines; Privacy; Terms; Help; Report abuse ...

Flickr.com

#ranikamalapatirailwaystation, #shorts, #shortsvideo, …

#ranikamalapatirailwaystation, #shorts, #shortsvideo, #currentaffairs #viral, #viralvideo, #gs, #gk, #shorts, #shortsvideo, #viral, #viralvideo, #gs, #gk, #c...

Youtube.com

Rani Kamalapati Railway Station Redeveloped by Bansal Group

2021-11-26  · The newly redeveloped #RaniKamalapatiRailwayStation formerly known as #Habibganj has been designed & built with the ultra-modern amenities like air-conditioned...

Archive.org


Domains Expiration Date Updated

Site Provider Expiration Date
lafondadelarcedianodemedina.com dinahosting.com 79 Days
carazoenterprise.com directnic.com 1 Year, 95 Days
ngu.org onlinenic.com 224 Days
selfiebox.in godaddy.com 2 Years, 246 Days
vagaseestagios.com enomdomains.com 1 Year, 12 Days
cswplumbingheating.com ionos.com 139 Days
2048.onl name.com 344 Days
waimanwu.com namesilo.com 344 Days
5dakika.com godaddy.com 61 Days
vacuumchamber.com godaddy.com 154 Days

    Browser All

    .com2.6M domains   

    .org0.9M domains   

    .edu30.9K domains   

    .net528.6K domains   

    .gov11.5K domains   

    .us17.8K domains   

    .ca34.7K domains   

    .de538.3K domains   

    .uk455.4K domains   

    .it24.2K domains   

    .au36.5K domains   

    .co24.5K domains   

    .biz7.9K domains   

    .info23.3K domains   

    .fr22.4K domains   

    .eu15.9K domains   

    .ru99.5K domains   

    .ph4.3K domains   

    .in38.7K domains   

    .vn13.2K domains   

    .cn28.8K domains   

    .ro13.1K domains   

    .ch7.2K domains   

    .at6.9K domains   

    Browser All